Гліальний фібрилярний кислий білок

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Гліальний фібрилярний кислий білок
Ідентифікатори
Символи glial fibrillary acidic proteinGFAP
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE GFAP 203540 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

GFAP (англ. Glial fibrillary acidic protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 432 амінокислот, а молекулярна маса — 49 880[2].

Послідовність амінокислот
1020304050
MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRV
DFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAE
LNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLAT
VRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFL
RKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNM
HEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR
GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQ
DLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVS
EGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у цитоплазмі, проміжних філаментах.

Література[ред. | ред. код]

  • Reeves S.A., Helman L.J., Allison A., Israel M.A. (1989). Molecular cloning and primary structure of human glial fibrillary acidic protein.. Proc. Natl. Acad. Sci. U.S.A. 86: 5178 — 5182.  PubMed DOI:10.1073/pnas.86.13.5178
  • Isaacs A., Baker M., Wavrant-De Vrieze F., Hutton M. (1998). Determination of the gene structure of human GFAP and absence of coding region mutations associated with frontotemporal dementia with parkinsonism linked to chromosome 17.. Genomics 51: 152 — 154.  PubMed DOI:10.1006/geno.1998.5360
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Nakatani Y., Brenner M., Freese E. (1990). An RNA polymerase II promoter containing sequences upstream and downstream from the RNA startpoint that direct initiation of transcription from the same site.. Proc. Natl. Acad. Sci. U.S.A. 87: 4289 — 4293.  PubMed DOI:10.1073/pnas.87.11.4289
  • Duguid J.R., Bohmont C.W., Liu N.G., Tourtellotte W.W. (1989). Changes in brain gene expression shared by scrapie and Alzheimer disease.. Proc. Natl. Acad. Sci. U.S.A. 86: 7260 — 7264.  PubMed DOI:10.1073/pnas.86.18.7260
  • Singh R., Nielsen A.L., Johansen M.G., Jorgensen A.L. (2003). Genetic polymorphism and sequence evolution of an alternatively spliced exon of the glial fibrillary acidic protein gene, GFAP.. Genomics 82: 185 — 193.  PubMed DOI:10.1016/S0888-7543(03)00106-X

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:4235 (англ.). Процитовано 12 вересня 2017. 
  2. UniProt, P14136 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]