KIF22

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KIF22
Protein KIF22 PDB 2EDU.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KIF22, A-328A3.2, KID, KNSL4, OBP, OBP-1, OBP-2, SEMDJL2, kinesin family member 22
Зовнішні ІД OMIM: 603213 MGI: 109233 HomoloGene: 32011 GeneCards: KIF22
Пов'язані генетичні захворювання
spondyloepimetaphyseal dysplasia with multiple dislocations[1]
Шаблон експресії
PBB GE KIF22 216969 s at fs.png

PBB GE KIF22 202183 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001256269
NM_001256270
NM_007317
NM_145588
RefSeq (білок)
NP_001243198
NP_001243199
NP_015556
NP_663563
Локус (UCSC) Хр. 16: 29.79 – 29.81 Mb Хр. 7: 127.03 – 127.04 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KIF22 (англ. Kinesin family member 22) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 665 амінокислот, а молекулярна маса — 73 262[5].

Послідовність амінокислот
1020304050
MAAGGSTQQRRREMAAASAAAISGAGRCRLSKIGATRRPPPARVRVAVRL
RPFVDGTAGASDPPCVRGMDSCSLEIANWRNHQETLKYQFDAFYGERSTQ
QDIYAGSVQPILRHLLEGQNASVLAYGPTGAGKTHTMLGSPEQPGVIPRA
LMDLLQLTREEGAEGRPWALSVTMSYLEIYQEKVLDLLDPASGDLVIRED
CRGNILIPGLSQKPISSFADFERHFLPASRNRTVGATRLNQRSSRSHAVL
LVKVDQRERLAPFRQREGKLYLIDLAGSEDNRRTGNKGLRLKESGAINTS
LFVLGKVVDALNQGLPRVPYRDSKLTRLLQDSLGGSAHSILIANIAPERR
FYLDTVSALNFAARSKEVINRPFTNESLQPHALGPVKLSQKELLGPPEAK
RARGPEEEEIGSPEPMAAPASASQKLSPLQKLSSMDPAMLERLLSLDRLL
ASQGSQGAPLLSTPKRERMVLMKTVEEKDLEIERLKTKQKELEAKMLAQK
AEEKENHCPTMLRPLSHRTVTGAKPLKKAVVMPLQLIQEQAASPNAEIHI
LKNKGRKRKLESLDALEPEEKAEDCWELQISPELLAHGRQKILDLLNEGS
ARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESFLK
ANILGLAAGQRCGAS

Кодований геном білок за функціями належить до білкових моторів, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, ДНК. Локалізований у цитоплазмі, цитоскелеті, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Santamaria A., Nagel S., Sillje H.H.W., Nigg E.A. (2008). The spindle protein CHICA mediates localization of the chromokinesin Kid to the mitotic spindle.. Curr. Biol. 18: 723 — 729.  PubMed DOI:10.1016/j.cub.2008.04.041
  • Iemura K., Tanaka K. (2015). Chromokinesin Kid and kinetochore kinesin CENP-E differentially support chromosome congression without end-on attachment to microtubules.. Nat. Commun. 6: 6447 — 6447.  PubMed DOI:10.1038/ncomms7447

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]