HMGN4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HMGN4
Ідентифікатори
Символи HMGN4, HMG17L3, NHC, high mobility group nucleosomal binding domain 4
Зовнішні ІД HomoloGene: 105484 GeneCards: HMGN4
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006353
н/д
RefSeq (білок)
NP_006344
NP_006344.1
н/д
Локус (UCSC) Хр. 6: 26.54 – 26.55 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

HMGN4 (англ. High mobility group nucleosomal binding domain 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 90 амінокислот, а молекулярна маса — 9 539[3].

Послідовність амінокислот
1020304050
MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGE
KLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як ацетилювання. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:4989 (англ.). Процитовано 6 вересня 2017. 
  3. UniProt, O00479 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]