CEBPZ

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CEBPZ
Ідентифікатори
Символи CEBPZ, CBF, CBF2, HSP-CBF, NOC1, CCAAT/enhancer binding protein zeta, CCAAT enhancer binding protein zeta
Зовнішні ІД OMIM: 612828 MGI: 109386 HomoloGene: 4210 GeneCards: CEBPZ
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005760
NM_001024806
NM_009882
RefSeq (білок)
NP_005751
NP_001019977
Локус (UCSC) Хр. 2: 37.2 – 37.23 Mb Хр. 17: 78.92 – 78.94 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CEBPZ (англ. CCAAT/enhancer binding protein zeta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 1 054 амінокислот, а молекулярна маса — 120 974[4].

Послідовність амінокислот
1020304050
MAAVKEPLEFHAKRPWRPEEAVEDPDEEDEDNTSEAENGFSLEEVLRLGG
TKQDYLMLATLDENEEVIDGGKKGAIDDLQQGELEAFIQNLNLAKYTKAS
LVEEDEPAEKENSSKKEVKIPKINNKNTAESQRTSVNKVKNKNRPEPHSD
ENGSTTPKVKKDKQNIFEFFERQTLLLRPGGKWYDLEYSNEYSLKPQPQD
VVSKYKTLAQKLYQHEINLFKSKTNSQKGASSTWMKAIVSSGTLGDRMAA
MILLIQDDAVHTLQFVETLVNLVKKKGSKQQCLMALDTFKELLITDLLPD
NRKLRIFSQRPFDKLEQLSSGNKDSRDRRLILWYFEHQLKHLVAEFVQVL
ETLSHDTLVTTKTRALTVAHELLCNKPEEEKALLVQVVNKLGDPQNRIAT
KASHLLETLLCKHPNMKGVVSGEVERLLFRSNISSKAQYYAICFLNQMAL
SHEESELANKLITVYFCFFRTCVKKKDVESKMLSALLTGVNRAYPYSQTG
DDKVREQIDTLFKVLHIVNFNTSVQALMLLFQVMNSQQTISDRYYTALYR
KMLDPGLMTCSKQAMFLNLVYKSLKADIVLRRVKAFVKRLLQVTCQQMPP
FICGALYLVSEILKAKPGLRSQLDDHPESDDEENFIDANDDEDMEKFTDA
DKETEIVKKLETEETVPETDVETKKPEVASWVHFDNLKGGKQLNKYDPFS
RNPLFCGAENTSLWELKKLSVHFHPSVALFAKTILQGNYIQYSGDPLQDF
TLMRFLDRFVYRNPKPHKGKENTDSVVMQPKRKHFIKDIRHLPVNSKEFL
AKEESQIPVDEVFFHRYYKKVAVKEKQKRDADEESIEDVDDEEFEELIDT
FEDDNCFSSGKDDMDFAGNVKKRTKGAKDNTLDEDSEGSDDELGNLDDDE
VSLGSMDDEEFAEVDEDGGTFMDVLDDESESVPELEVHSKVSTKKSKRKG
TDDFDFAGSFQGPRKKKRNLNDSSLFVSAEEFGHLLDENMGSKFDNIGMN
AMANKDNASLKQLRWEAERDDWLHNRDAKSIIKKKKHFKKKRIKTTQKTK
KQRK

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм, ацетиляція. Локалізований у ядрі.

Література[ред. | ред. код]

  • Lum L., Sultzman L., Kaufman R., Linzer D.I.H., Wu B. (1990). A cloned human CCAAT-box-binding factor stimulates transcription from the human hsp70 promoter.. Mol. Cell. Biol. 10: 6709 — 6717.  PubMed DOI:10.1128/MCB.10.12.6709
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:24218 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q03701 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]