GLI3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GLI3
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GLI3, ACLS, GCPS, GLI3-190, GLI3FL, PAP-A, PAPA, PAPA1, PAPB, PHS, PPDIV, GLI family zinc finger 3
Зовнішні ІД OMIM: 165240 MGI: 95729 HomoloGene: 139 GeneCards: GLI3
Пов'язані генетичні захворювання
макулодистрофія, Поліноз, Greig cephalopolysyndactyly syndrome, Pallister-Hall syndrome[1]
Шаблон експресії
PBB GE GLI3 205201 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000168
NM_008130
RefSeq (білок)
NP_000159
NP_032156
Локус (UCSC) Хр. 7: 41.96 – 42.24 Mb Хр. 13: 15.46 – 15.73 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GLI3 (англ. GLI family zinc finger 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 580 амінокислот, а молекулярна маса — 169 863[5].

Послідовність амінокислот
1020304050
MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTY
HRERRNAITMQPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEP
SVPYRGTVFAMDPRNGYMEPHYHPPHLFPAFHPPVPIDARHHEGRYHYDP
SPIPPLHMTSALSSSPTYPDLPFIRISPHRNPTAASESPFSPPHPYINPY
MDYIRSLHSSPSLSMISATRGLSPTDAPHAGVSPAEYYHQMALLTGQRSP
YADIIPSAATAGTGAIHMEYLHAMDSTRFSSPRLSARPSRKRTLSISPLS
DHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTY
SSAPVSLHMHQQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVL
NPVQVSSGPSESSQNKPTSESAVSSTGDPMHNKRSKIKPDEDLPSPGARG
QQEQPEGTTLVKEEGDKDESKQEPEVIYETNCHWEGCAREFDTQEQLVHH
INNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRHTGEKPHKCTF
EGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRT
HSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDIHPRP
PPPRDSGSHSQSRSPGRPTQGALGEQQDLSNTTSKREECLQVKTVKAEKP
MTSQPSPGGQSSCSSQQSPISNYSNSGLELPLTDGGSIGDLSAIDETPIM
DSTISTATTALALQARRNPAGTKWMEHVKLERLKQVNGMFPRLNPILPPK
APAVSPLIGNGTQSNNTCSLGGPMTLLPGRSDLSGVDVTMLNMLNRRDSS
ASTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPIST
DASRRSSEASQSDGLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMER
MSLKTRLALLGDALEPGVALPPVHAPRRCSDGGAHGYGRRHLQPHDAPGH
GVRRASDPVRTGSEGLALPRVPRFSSLSSCNPPAMATSAEKRSLVLQNYT
RPEGGQSRNFHSSPCPPSITENVTLESLTMDADANLNDEDFLPDDVVQYL
NSQNQAGYEQHFPSALPDDSKVPHGPGDFDAPGLPDSHAGQQFHALEQPC
PEGSKTDLPIQWNEVSSGSADLSSSKLKCGPRPAVPQTRAFGFCNGMVVH
PQNPLRSGPAGGYQTLGENSNPYGGPEHLMLHNSPGSGTSGNAFHEQPCK
APQYGNCLNRQPVAPGALDGACGAGIQASKLKSTPMQGSGGQLNFGLPVA
PNESAGSMVNGMQNQDPVGQGYLAHQLLGDSMQHPGAGRPGQQMLGQISA
TSHINIYQGPESCLPGAHGMGSQPSSLAVVRGYQPCASFGGSRRQAMPRD
SLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYSGQFYDQTVGF
SQQDTKAGSFSISDASCLLQGTSAKNSELLSPGANQVTSTVDSLDSHDLE
GVQIDFDAIIDDGDHSSLMSGALSPSIIQNLSHSSSRLTTPRASLPFPAL
SMSTTNMAIGDMSSLLTSLAEESKFLAVMQ

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі, клітинних відростках, війках.

Література[ред. | ред. код]

  • Ruppert J.M., Vogelstein B., Arheden K., Kinzler K.W. (1990). GLI3 encodes a 190-kilodalton protein with multiple regions of GLI similarity.. Mol. Cell. Biol. 10: 5408 — 5415.  PubMed DOI:10.1128/MCB.10.10.5408
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Wang B., Fallon J.F., Beachy P.A. (2000). Hedgehog-regulated processing of Gli3 produces an anterior/posterior repressor gradient in the developing vertebrate limb.. Cell 100: 423 — 434.  PubMed DOI:10.1016/S0092-8674(00)80678-9
  • Koyabu Y., Nakata K., Mizugishi K., Aruga J., Mikoshiba K. (2001). Physical and functional interactions between Zic and Gli proteins.. J. Biol. Chem. 276: 6889 — 6892.  PubMed DOI:10.1074/jbc.C000773200
  • Tempe D., Casas M., Karaz S., Blanchet-Tournier M.F., Concordet J.P. (2006). Multisite protein kinase A and glycogen synthase kinase 3beta phosphorylation leads to Gli3 ubiquitination by SCFbetaTrCP.. Mol. Cell. Biol. 26: 4316 — 4326.  PubMed DOI:10.1128/MCB.02183-05
  • Wang B., Li Y. (2006). Evidence for the direct involvement of {beta}TrCP in Gli3 protein processing.. Proc. Natl. Acad. Sci. U.S.A. 103: 33 — 38.  PubMed DOI:10.1073/pnas.0509927103

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]