MAF

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MAF
Ідентифікатори
Символи MAF, CCA4, c-AYGRP, CTRCT21, MAF bZIP transcription factor
Зовнішні ІД OMIM: 177075 MGI: 96909 HomoloGene: 74552 GeneCards: MAF
Пов'язані генетичні захворювання
cataract 21 multiple types, Ayme-Gripp syndrome[1]
Шаблон експресії
PBB GE MAF 206363 at fs.png

PBB GE MAF 209347 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001031804
NM_005360
NM_001025577
RefSeq (білок)
NP_001026974
NP_005351
NP_001020748
Локус (UCSC) Хр. 16: 79.59 – 79.6 Mb Хр. 8: 115.68 – 115.71 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MAF (англ. MAF bZIP transcription factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 373 амінокислот, а молекулярна маса — 38 492[5].

Послідовність амінокислот
1020304050
MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLI
AGGSLSSTPMSTPCSSVPPSPSFSAPSPGSGSEQKAHLEDYYWMTGYPQQ
LNPEALGFSPEDAVEALISNSHQLQGGFDGYARGAQQLAAAAGAGAGASL
GGSGEEMGPAAAVVSAVIAAAAAQSGAGPHYHHHHHHAAGHHHHPTAGAP
GAAGSAAASAGGAGGAGGGGPASAGGGGGGGGGGGGGGAAGAGGALHPHH
AAGGLHFDDRFSDEQLVTMSVRELNRQLRGVSKEEVIRLKQKRRTLKNRG
YAQSCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEK
LVSSGFRENGSSSDNPSSPEFFM

Кодований геном білок за функціями належить до репресорів, активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Dhakshinamoorthy S., Jaiswal A.K. (2002). c-Maf negatively regulates ARE-mediated detoxifying enzyme genes expression and anti-oxidant induction.. Oncogene 21: 5301 — 5312.  PubMed DOI:10.1038/sj.onc.1205642
  • Mahoney K.M., Petrovic N., Schacke W., Shapiro L.H. (2007). CD13/APN transcription is regulated by the proto-oncogene c-Maf via an atypical response element.. Gene 403: 178 — 187.  PubMed DOI:10.1016/j.gene.2007.08.010
  • Eychene A., Rocques N., Pouponnot C. (2008). A new MAFia in cancer.. Nat. Rev. Cancer 8: 683 — 693.  PubMed DOI:10.1038/nrc2460
  • Vanita V., Singh D., Robinson P.N., Sperling K., Singh J.R. (2006). A novel mutation in the DNA-binding domain of MAF at 16q23.1 associated with autosomal dominant 'cerulean cataract' in an Indian family.. Am. J. Med. Genet. A 140: 558 — 566.  PubMed DOI:10.1002/ajmg.a.31126

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]