NR1H3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NR1H3
Protein NR1H3 PDB 1uhl.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR1H3, LXR-a, LXRA, RLD-1, Liver X receptor alpha, nuclear receptor subfamily 1 group H member 3
Зовнішні ІД OMIM: 602423 MGI: 1352462 HomoloGene: 21165 GeneCards: NR1H3
Пов'язані генетичні захворювання
metabolic disease[1]
Реагує на сполуку
(25R)-cholest-5-ene-3β,26-diol, desmosterol[2]
Шаблон експресії
PBB GE NR1H3 203920 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001130101
NM_001130102
NM_001251934
NM_001251935
NM_005693
NM_001177730
NM_013839
NM_001355279
RefSeq (білок)
NP_001171201
NP_038867
NP_001342208
Локус (UCSC) Хр. 11: 47.25 – 47.27 Mb Хр. 2: 91.18 – 91.2 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR1H3 (англ. Nuclear receptor subfamily 1 group H member 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 447 амінокислот, а молекулярна маса — 50 396[6].

Послідовність амінокислот
1020304050
MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSA
GGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSV
CGDKASGFHYNVLSCEGCKGFFRRSVIKGAHYICHSGGHCPMDTYMRRKC
QECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAHATSLPPRASSPP
QILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREAR
QQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQ
LNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHD
RLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE

Кодований геном білок за функціями належить до рецепторів, активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]