ATF3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ATF3
Ідентифікатори
Символи ATF3, activating transcription factor 3
Зовнішні ІД OMIM: 603148 MGI: 109384 HomoloGene: 1265 GeneCards: ATF3
Шаблон експресії
PBB GE ATF3 202672 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_007498
RefSeq (білок)
NP_031524
Локус (UCSC) Хр. 1: 212.57 – 212.62 Mb Хр. 1: 191.17 – 191.22 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ATF3 (англ. Activating transcription factor 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 181 амінокислот, а молекулярна маса — 20 576[4].

Послідовність амінокислот
1020304050
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQ
NKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAA
AKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHR
PTCIVRAQNGRTPEDERNLFIQQIKEGTLQS

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Pan Y., Chen H., Siu F., Kilberg M.S. (2003). Amino acid deprivation and endoplasmic reticulum stress induce expression of multiple activating transcription factor-3 mRNA species that, when overexpressed in HepG2 cells, modulate transcription by the human asparagine synthetase promoter.. J. Biol. Chem. 278: 38402 — 38412.  PubMed DOI:10.1074/jbc.M304574200
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hai T., Liu F., Coukos W.J., Green M.R. (1989). Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers.. Genes Dev. 3: 2083 — 2090.  PubMed DOI:10.1101/gad.3.12b.2083
  • Hillman R.T., Green R.E., Brenner S.E. (2004). An unappreciated role for RNA surveillance.. Genome Biol. 5: R8.1 — R8.16.  PubMed DOI:10.1186/gb-2004-5-2-r8
  • Chen B.P.C., Liang G., Whelan J., Hai T. (1994). ATF3 and ATF3 delta Zip. Transcriptional repression versus activation by alternatively spliced isoforms.. J. Biol. Chem. 269: 15819 — 15826.  PubMed
  • Hai T., Liu F., Coukos W.J., Green M.R. (1990). Genes Dev. 4: 682 — 682. 

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:785 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, P18847 (англ.). Процитовано 25 серпня 2017. 

Див. також[ред. | ред. код]