ZNF34

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF34
Ідентифікатори
Символи ZNF34, KOX32, zinc finger protein 34
Зовнішні ІД OMIM: 194526 HomoloGene: 88920 GeneCards: ZNF34
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001286769
NM_001286770
NM_030580
н/д
RefSeq (білок)
NP_001273698
NP_001273699
NP_085057
н/д
Локус (UCSC) Хр. 8: 144.77 – 144.79 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

ZNF34 (англ. Zinc finger protein 34) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 560 амінокислот, а молекулярна маса — 64 038[3].

Послідовність амінокислот
1020304050
MLLLLSDQLLLTALRKPNPQAMAALFLSAPPQAEVTFEDVAVYLSREEWG
RLGPAQRGLYRDVMLETYGNLVSLGVGPAGPKPGVISQLERGDEPWVLDV
QGTSGKEHLRVNSPALGTRTEYKELTSQETFGEEDPQGSEPVEACDHISK
SEGSLEKLVEQRGPRAVTLTNGESSRESGGNLRLLSRPVPDQRPHKCDIC
EQSFEQRSYLNNHKRVHRSKKTNTVRNSGEIFSANLVVKEDQKIPTGKKL
HYCSYCGKTFRYSANLVKHQRLHTEEKPYKCDECGKAFSQSCEFINHRRM
HSGEIPYRCDECGKTFTRRPNLMKHQRIHTGEKPYKCGECGKHFSAYSSL
IYHQRIHTGEKPYKCNDCGKAFSDGSILIRHRRTHTGEKPFECKECGKGF
TQSSNLIQHQRIHTGEKPYKCNECEKAFIQKTKLVEHQRSHTGEKPYECN
DCGKVFSQSTHLIQHQRIHTGEKPYKCSECGKAFHNSSRLIHHQRLHHGE
KPYRCSDCKKAFSQSTYLIQHRRIHTGEKPYKCSECGKAFRHSSNMCQHQ
RIHLREDFSM

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:13098 (англ.). Процитовано 7 вересня 2017. 
  3. UniProt, Q8IZ26 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]