ING4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ING4
Protein ING4 PDB 1wen.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ING4, my036, p29inhibitor of growth family member 4
Зовнішні ІД OMIM: 608524 MGI: 107307 HomoloGene: 22952 GeneCards: ING4
Шаблон експресії
PBB GE ING4 48825 at fs.png

PBB GE ING4 218234 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_133345
NM_144510
NM_001368695
RefSeq (білок)
NP_579923
NP_001355624
Локус (UCSC) Хр. 12: 6.65 – 6.66 Mb Хр. 6: 125.04 – 125.05 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ING4 (англ. Inhibitor of growth family member 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 249 амінокислот, а молекулярна маса — 28 530[4].

Послідовність амінокислот
1020304050
MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYM
SSARSLSSEEKLALLKQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRL
DTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNS
DEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCL
CHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK

Кодований геном білок за функцією належить до регуляторів хроматину. Задіяний у таких біологічних процесах, як апоптоз, клітинний цикл, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у ядрі.

Література[ред. | ред. код]

  • Unoki M., Shen J.C., Zheng Z.M., Harris C.C. (2006). Novel splice variants of ING4 and their possible roles in the regulation of cell growth and motility.. J. Biol. Chem. 281: 34677 — 34686.  PubMed DOI:10.1074/jbc.M606296200
  • Raho G., Miranda C., Tamborini E., Pierotti M.A., Greco A. (2007). Detection of novel mRNA splice variants of human ING4 tumor suppressor gene.. Oncogene 26: 5247 — 5257.  PubMed DOI:10.1038/sj.onc.1210335
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kim S., Chin K., Gray J.W., Bishop J.M. (2004). A screen for genes that suppress loss of contact inhibition: Identification of ING4 as a candidate tumor suppressor gene in human cancer.. Proc. Natl. Acad. Sci. U.S.A. 101: 16251 — 16256.  PubMed DOI:10.1073/pnas.0407158101
  • Ozer A., Wu L.C., Bruick R.K. (2005). The candidate tumor suppressor ING4 represses activation of the hypoxia inducible factor (HIF).. Proc. Natl. Acad. Sci. U.S.A. 102: 7481 — 7486.  PubMed DOI:10.1073/pnas.0502716102
  • Guo Q., Fast W. (2011). Citrullination of inhibitor of growth 4 (ING4) by peptidylarginine deminase 4 (PAD4) disrupts the interaction between ING4 and p53.. J. Biol. Chem. 286: 17069 — 17078.  PubMed DOI:10.1074/jbc.M111.230961

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:19423 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q9UNL4 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]