PHF8

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PHF8
Protein PHF8 PDB 2WWU.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PHF8, JHDM1F, MRXSSD, ZNF422, PHD finger protein 8, KDM7B
Зовнішні ІД OMIM: 300560 MGI: 2444341 HomoloGene: 49405 GeneCards: PHF8
Пов'язані генетичні захворювання
Біполярний афективний розлад, шизофренія, syndromic X-linked intellectual disability Siderius type[1]
Реагує на сполуку
daminozide[2]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001184896
NM_001184897
NM_001184898
NM_015107
NM_001113354
NM_177201
RefSeq (білок)
NP_001171825
NP_001171826
NP_001171827
NP_055922
NP_001106825
NP_796175
Локус (UCSC) Хр. X: 53.94 – 54.05 Mb Хр. X: 151.52 – 151.63 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PHF8 (англ. PHD finger protein 8) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[5] Довжина поліпептидного ланцюга білка становить 1 060 амінокислот, а молекулярна маса — 117 864[6].

Послідовність амінокислот
1020304050
MNRSRAIVQRGRVLPPPAPLDTTNLAGRRTLQGRAKMASVPVYCLCRLPY
DVTRFMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNCEVLHGPSIMKK
RRGSSKGHDTHKGKPVKTGSPTFVRELRSRTFDSSDEVILKPTGNQLTVE
FLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTR
QADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLS
WVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEK
IFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIP
TGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNF
ETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALP
DHEDEIPETVRTVQLIKDLAREIRLVEDIFQQNVGKTSNIFGLQRIFPAG
SIPLTRPAHSTSVSMSRLSLPSKNGSKKKGLKPKELFKKAERKGKESSAL
GPAGQLSYNLMDTYSHQALKTGSFQKAKFNITGACLNDSDDDSPDLDLDG
NESPLALLMSNGSTKRVKSLSKSRRTKIAKKVDKARLMAEQVMEDEFDLD
SDDELQIDERLGKEKATLIIRPKFPRKLPRAKPCSDPNRVREPGEVEFDI
EEDYTTDEDMVEGVEGKLGNGSGAGGILDLLKASRQVGGPDYAALTEAPA
SPSTQEAIQGMLCMANLQSSSSSPATSSLQAWWTGGQDRSSGSSSSGLGT
VSNSPASQRTPGKRPIKRPAYWRTESEEEEENASLDEQDSLGACFKDAEY
IYPSLESDDDDPALKSRPKKKKNSDDAPWSPKARVTPTLPKQDRPVREGT
RVASIETGLAAAAAKLAQQELQKAQKKKYIKKKPLLKEVEQPRPQDSNLS
LTVPAPTVAATPQLVTSSSPLPPPEPKQEALSGSLADHEYTARPNAFGMA
QANRSTTPMAPGVFLTQRRPSVGSQSNQAGQGKRPKKGLATAKQRLGRIL
KIHRNGKLLL

Кодований геном білок за функціями належить до оксидоредуктаз, активаторів, регуляторів хроматину, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, клітинний цикл, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, іоном заліза. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Feng W., Yonezawa M., Ye J., Jenuwein T., Grummt I. (2010). PHF8 activates transcription of rRNA genes through H3K4me3 binding and H3K9me1/2 demethylation.. Nat. Struct. Mol. Biol. 17: 445 — 450.  PubMed DOI:10.1038/nsmb.1778

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]