ZBTB20

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZBTB20
Ідентифікатори
Символи ZBTB20, DPZF, HOF, ODA-8S, ZNF288, PRIMS, zinc finger and BTB domain containing 20
Зовнішні ІД MGI: 1929213 HomoloGene: 9226 GeneCards: ZBTB20
Шаблон експресії
PBB GE ZBTB20 205383 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001285805
NM_019778
NM_181058
RefSeq (білок)
NP_001272734
NP_062752
NP_851401
Локус (UCSC) Хр. 3: 114.31 – 115.15 Mb Хр. 16: 42.88 – 43.64 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZBTB20 (англ. Zinc finger and BTB domain containing 20) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 741 амінокислот, а молекулярна маса — 81 083[4].

Послідовність амінокислот
1020304050
MLERKKPKTAENQKASEENEITQPGGSSAKPGLPCLNFEAVLSPDPALIH
STHSLTNSHAHTGSSDCDISCKGMTERIHSINLHNFSNSVLETLNEQRNR
GHFCDVTVRIHGSMLRAHRCVLAAGSPFFQDKLLLGYSDIEIPSVVSVQS
VQKLIDFMYSGVLRVSQSEALQILTAASILQIKTVIDECTRIVSQNVGDV
FPGIQDSGQDTPRGTPESGTSGQSSDTESGYLQSHPQHSVDRIYSALYAC
SMQNGSGERSFYSGAVVSHHETALGLPRDHHMEDPSWITRIHERSQQMER
YLSTTPETTHCRKQPRPVRIQTLVGNIHIKQEMEDDYDYYGQQRVQILER
NESEECTEDTDQAEGTESEPKGESFDSGVSSSIGTEPDSVEQQFGPGAAR
DSQAEPTQPEQAAEAPAEGGPQTNQLETGASSPERSNEVEMDSTVITVSN
SSDKSVLQQPSVNTSIGQPLPSTQLYLRQTETLTSNLRMPLTLTSNTQVI
GTAGNTYLPALFTTQPAGSGPKPFLFSLPQPLAGQQTQFVTVSQPGLSTF
TAQLPAPQPLASSAGHSTASGQGEKKPYECTLCNKTFTAKQNYVKHMFVH
TGEKPHQCSICWRSFSLKDYLIKHMVTHTGVRAYQCSICNKRFTQKSSLN
VHMRLHRGEKSYECYICKKKFSHKTLLERHVALHSASNGTPPAGTPPGAR
AGPPGVVACTEGTTYVCSVCPAKFDQIEQFNDHMRMHVSDG

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proc. Natl. Acad. Sci. U.S.A. 111: 12432 — 12437.  PubMed DOI:10.1073/pnas.1413825111
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13503 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q9HC78 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]