NR2F6

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NR2F6
Ідентифікатори
Символи NR2F6, EAR-2, EAR2, ERBAL2, nuclear receptor subfamily 2 group F member 6
Зовнішні ІД OMIM: 132880 MGI: 1352453 HomoloGene: 7706 GeneCards: NR2F6
Шаблон експресії
PBB GE NR2F6 209261 s at fs.png

PBB GE NR2F6 209262 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005234
NM_010150
RefSeq (білок)
NP_005225
NP_005225.2
NP_034280
Локус (UCSC) Хр. 19: 17.23 – 17.25 Mb Хр. 8: 71.37 – 71.38 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR2F6 (англ. Nuclear receptor subfamily 2 group F member 6) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 404 амінокислот, а молекулярна маса — 42 979[4].

Послідовність амінокислот
1020304050
MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP
GLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQI
DQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSA
LAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGID
NVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQA
ALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSA
EYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRF
GRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPY
GSGQ

Кодований геном білок за функціями належить до репресорів, рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Zhang Y., Dufau M.L. (2000). Nuclear orphan receptors regulate transcription of the gene for the human luteinizing hormone receptor.. J. Biol. Chem. 275: 2763 — 2770.  PubMed DOI:10.1074/jbc.275.4.2763
  • Zhang Y., Dufau M.L. (2001). EAR2 and EAR3/COUP-TFI regulate transcription of the rat LH receptor.. Mol. Endocrinol. 15: 1891 — 1905.  PubMed DOI:10.1210/mend.15.11.0720

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7977 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P10588 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]