ZBTB32

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZBTB32
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ZBTB32, FAXF, FAZF, Rog, TZFP, ZNF538, zinc finger and BTB domain containing 32
Зовнішні ІД OMIM: 605859 MGI: 1891838 HomoloGene: 8661 GeneCards: ZBTB32
Шаблон експресії
PBB GE ZBTB32 220118 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_014383
NM_001316902
NM_001316903
NM_021397
RefSeq (білок)
NP_001303831
NP_001303832
NP_055198
NP_067372
Локус (UCSC) Хр. 19: 35.7 – 35.72 Mb Хр. 7: 30.59 – 30.6 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZBTB32 (англ. Zinc finger and BTB domain containing 32) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 487 амінокислот, а молекулярна маса — 52 963[4].

Послідовність амінокислот
1020304050
MSLPPIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGV
SQQLGRRGQWALGEGISPSTFAQLLNFVYGESVELQPGELRPLQEAARAL
GVQSLEEACWRARGDRAKKPDPGLKKHQEEPEKPSRNPERELGDPGEKQK
PEQVSRTGGREQEMLHKHSPPRGRPEMAGATQEAQQEQTRSKEKRLQAPV
GQRGADGKHGVLTWLRENPGGSEESLRKLPGPLPPAGSLQTSVTPRPSWA
EAPWLVGGQPALWSILLMPPRYGIPFYHSTPTTGAWQEVWREQRIPLSLN
APKGLWSQNQLASSSPTPGSLPQGPAQLSPGEMEESDQGHTGALATCAGH
EDKAGCPPRPHPPPAPPARSRPYACSVCGKRFSLKHQMETHYRVHTGEKP
FSCSLCPQRSRDFSAMTKHLRTHGAAPYRCSLCGAGCPSLASMQAHMRGH
SPSQLPPGWTIRSTFLYSSSRPSRPSTSPCCPSSSTT

Кодований геном білок за функцією належить до репресорів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Lin W.-C., Lai C.-H., Tang C.J., Huang C.-J., Tang T.K. (1999). Identification and gene structure of a novel human PLZF-related transcription factor gene, TZFP.. Biochem. Biophys. Res. Commun. 264: 789 — 795.  PubMed DOI:10.1006/bbrc.1999.1594
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Stogios P.J., Cuesta-Seijo J.A., Chen L., Pomroy N.C., Prive G.G. (2010). Insights into strand exchange in BTB domain dimers from the crystal structures of FAZF and Miz1.. J. Mol. Biol. 400: 983 — 997.  PubMed DOI:10.1016/j.jmb.2010.05.028

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:16763 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q9Y2Y4 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]