GATA6

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GATA6
Ідентифікатори
Символи GATA6, GATA binding protein 6
Зовнішні ІД OMIM: 601656 MGI: 107516 HomoloGene: 68449 GeneCards: GATA6
Пов'язані генетичні захворювання
atrial heart septal defect 9, Тетрада Фалло[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005257
NM_010258
RefSeq (білок)
NP_005248
NP_034388
Локус (UCSC) Хр. 18: 22.17 – 22.2 Mb Хр. 18: 11.05 – 11.09 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GATA6 (англ. GATA binding protein 6) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 18-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 595 амінокислот, а молекулярна маса — 60 033[5].

Послідовність амінокислот
1020304050
MALTDGGWCLPKRFGAAGADASDSRAFPAREPSTPPSPISSSSSSCSRGG
ERGPGGASNCGTPQLDTEAAAGPPARSLLLSSYASHPFGAPHGPSAPGVA
GPGGNLSSWEDLLLFTDLDQAATASKLLWSSRGAKLSPFAPEQPEEMYQT
LAALSSQGPAAYDGAPGGFVHSAAAAAAAAAAASSPVYVPTTRVGSMLPG
LPYHLQGSGSGPANHAGGAGAHPGWPQASADSPPYGSGGGAAGGGAAGPG
GAGSAAAHVSARFPYSPSPPMANGAAREPGGYAAAGSGGAGGVSGGGSSL
AAMGGREPQYSSLSAARPLNGTYHHHHHHHHHHPSPYSPYVGAPLTPAWP
AGPFETPVLHSLQSRAGAPLPVPRGPSADLLEDLSESRECVNCGSIQTPL
WRRDGTGHYLCNACGLYSKMNGLSRPLIKPQKRVPSSRRLGLSCANCHTT
TTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKRKPKNINK
SKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAG
ESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Maitra M., Koenig S.N., Srivastava D., Garg V. (2010). Identification of GATA6 sequence variants in patients with congenital heart defects.. Pediatr. Res. 68: 281 — 285.  PubMed DOI:10.1203/PDR.0b013e3181ed17e4
  • Li J., Liu W.D., Yang Z.L., Yang Y.Q. (2012). Novel GATA6 loss-of-function mutation responsible for familial atrial fibrillation.. Int. J. Mol. Med. 30: 783 — 790.  PubMed DOI:10.3892/ijmm.2012.1068

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]