SOX13

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SOX13
Protein SOX13 PDB 1i11.png
Ідентифікатори
Символи SOX13, ICA12, Sox-13, SRY-box 13, SRY-box transcription factor 13
Зовнішні ІД OMIM: 604748 MGI: 98361 HomoloGene: 4159 GeneCards: SOX13
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005686
NM_011439
RefSeq (білок)
NP_005677
NP_035569
Локус (UCSC) Хр. 1: 204.07 – 204.13 Mb Хр. 1: 133.38 – 133.42 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SOX13 (англ. SRY-box 13) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 622 амінокислот, а молекулярна маса — 69 228[4].

Послідовність амінокислот
1020304050
MSMRSPISAQLALDGVGTMVNCTIKSEEKKEPCHEAPQGSATAAEPQPGD
PARASQDSADPQAPAQGNFRGSWDCSSPEGNGSPEPKRPGVSEAASGSQE
KLDFNRNLKEVVPAIEKLLSSDWKERFLGRNSMEAKDVKGTQESLAEKEL
QLLVMIHQLSTLRDQLLTAHSEQKNMAAMLFEKQQQQMELARQQQEQIAK
QQQQLIQQQHKINLLQQQIQQVNMPYVMIPAFPPSHQPLPVTPDSQLALP
IQPIPCKPVEYPLQLLHSPPAPVVKRPGAMATHHPLQEPSQPLNLTAKPK
APELPNTSSSPSLKMSSCVPRPPSHGGPTRDLQSSPPSLPLGFLGEGDAV
TKAIQDARQLLHSHSGALDGSPNTPFRKDLISLDSSPAKERLEDGCVHPL
EEAMLSCDMDGSRHFPESRNSSHIKRPMNAFMVWAKDERRKILQAFPDMH
NSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPKRT
CIVEGKRLRVGEYKALMRTRRQDARQSYVIPPQAGQVQMSSSDVLYPRAA
GMPLAQPLVEHYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYR
YSEDEDSEGEEKSDGELVVLTD

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11192 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q9UN79 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]