HNF4G

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HNF4G
Protein HNF4G PDB 1lv2.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HNF4G, NR2A2, NR2A3, Hepatocyte nuclear factor 4 gamma
Зовнішні ІД OMIM: 605966 MGI: 1353604 HomoloGene: 37886 GeneCards: HNF4G
Шаблон експресії
PBB GE HNF4G 207456 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004133
NM_001330561
NM_013920
RefSeq (білок)
NP_001317490
NP_004124
NP_038948
Локус (UCSC) Хр. 8: 75.41 – 75.57 Mb Хр. 3: 3.51 – 3.66 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HNF4G (англ. Hepatocyte nuclear factor 4 gamma) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 408 амінокислот, а молекулярна маса — 45 877[4].

Послідовність амінокислот
1020304050
MNTTDNGVNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRF
SRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTFDGSN
IPSINTLAQAEVRSRQISVSSPGSSTDINVKKIASIGDVCESMKQQLLVL
VEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMYKDILLLGNN
YVIHRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDA
KGLSDPVKIKNMRFQVQIGLEDYINDRQYDSRGRFGELLLLLPTLQSITW
QMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLT
GQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQ
HLSKQKQL

Кодований геном білок за функціями належить до рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Drewes T., Senkel S., Holewa B., Ryffel G.U. (1996). Human hepatocyte nuclear factor 4 isoforms are encoded by distinct and differentially expressed genes.. Mol. Cell. Biol. 16: 925 — 931.  PubMed DOI:10.1128/MCB.16.3.925
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5026 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, Q14541 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]