FOXF1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FOXF1
Ідентифікатори
Символи FOXF1, ACDMPV, FKHL5, FREAC1, forkhead box F1
Зовнішні ІД OMIM: 601089 MGI: 1347470 HomoloGene: 1114 GeneCards: FOXF1
Шаблон експресії
PBB GE FOXF1 205935 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001451
NM_010426
RefSeq (білок)
NP_001442
NP_034556
Локус (UCSC) Хр. 16: 86.51 – 86.52 Mb Хр. 8: 121.08 – 121.09 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FOXF1 (англ. Forkhead box F1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 379 амінокислот, а молекулярна маса — 40 122[4].

Послідовність амінокислот
1020304050
MSSAPEKQQPPHGGGGGGGGGGGAAMDPASSGPSKAKKTNAGIRRPEKPP
YSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNL
SLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQA
LKPMYSMMNGLGFNHLPDTYGFQGSAGGLSCPPNSLALEGGLGMMNGHLP
GNVDGMALPSHSVPHLPSNGGHSYMGGCGGAAAGEYPHHDSSVPASPLLP
TGAGGVMEPHAVYSGSAAAWPPSASAALNSGASYIKQQPLSPCNPAANPL
SGSLSTHSLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDRKEFVFSFNA
MASSSMHSAGGGSYYHQQVTYQDIKPCVM

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Hellqvist M., Mahlapuu M., Samuelsson L., Enerbaeck S., Carlsson P. (1996). Differential activation of lung-specific genes by two forkhead proteins, FREAC-1 and FREAC-2.. J. Biol. Chem. 271: 4482 — 4490.  PubMed DOI:10.1074/jbc.271.8.4482
  • Mahlapuu M., Pelto-Huikko M., Aitola M., Enerbaeck S., Carlsson P. (1998). FREAC-1 contains a cell-type-specific transcriptional activation domain and is expressed in epithelial-mesenchymal interfaces.. Dev. Biol. 202: 183 — 195.  PubMed DOI:10.1006/dbio.1998.9010
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Pierrou S., Hellqvist M., Samuelsson L., Enerbaeck S., Carlsson P. (1994). Cloning and characterization of seven human forkhead proteins: binding site specificity and DNA bending.. EMBO J. 13: 5002 — 5012.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3809 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q12946 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]