PBX3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PBX3
HoxB1-Pbx1 heterodimer binding DNA 1b72.png
Ідентифікатори
Символи PBX3, PBX homeobox 3
Зовнішні ІД OMIM: 176312 MGI: 97496 HomoloGene: 21243 GeneCards: PBX3
Шаблон експресії
PBB GE PBX3 204082 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001134778
NM_006195
NM_001330782
NM_001290576
NM_016768
RefSeq (білок)
NP_001128250
NP_001317711
NP_006186
NP_006186.1
NP_001277505
NP_058048
Локус (UCSC) Хр. 9: 125.75 – 125.97 Mb Хр. 2: 34.17 – 34.37 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PBX3 (англ. PBX homeobox 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 434 амінокислот, а молекулярна маса — 47 190[4].

Послідовність амінокислот
1020304050
MDDQSRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDIL
HQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRGAQE
EDPPDPQLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASGGSSDNSIEHS
DYRAKLTQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIE
RMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEIL
NEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKF
QEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSGSSGSFNLPNSGDM
FMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSP
HNLNANGGWQDATTPSSVTSPTEGPGSVHSDTSN

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Monica K., Galili N., Nourse J., Saltman D., Cleary M.L. (1991). PBX2 and PBX3, new homeobox genes with extensive homology to the human proto-oncogene PBX1.. Mol. Cell. Biol. 11: 6149 — 6157.  PubMed DOI:10.1128/MCB.11.12.6149
  • Milech N., Kees U.R., Watt P.M. (2001). Novel alternative PBX3 isoforms in leukemia cells with distinct interaction specificities.. Genes Chromosomes Cancer 32: 275 — 280.  PubMed DOI:10.1002/gcc.1190
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lu Q., Wright D.D., Kamps M.P. (1994). Fusion with E2A converts the Pbx1 homeodomain protein into a constitutive transcriptional activator in human leukemias carrying the t(1;19) translocation.. Mol. Cell. Biol. 14: 3938 — 3948.  PubMed DOI:10.1128/MCB.14.6.3938

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:8634 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, P40426 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]