BCL11B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
BCL11B
Ідентифікатори
Символи BCL11B, ATL1, ATL1-alpha, ATL1-beta, ATL1-delta, ATL1-gamma, CTIP-2, CTIP2, RIT1, ZNF856B, hRIT1-alpha, B-cell CLL/lymphoma 11B, IMD49, B cell CLL/lymphoma 11B, IDDFSTA, BAF complex component, BAF chromatin remodeling complex subunit BCL11B
Зовнішні ІД OMIM: 606558 MGI: 1929913 HomoloGene: 10974 GeneCards: BCL11B
Шаблон експресії
PBB GE BCL11B 219528 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001282237
NM_001282238
NM_022898
NM_138576
NM_001079883
NM_001286343
NM_021399
RefSeq (білок)
NP_001269166
NP_001269167
NP_075049
NP_612808
NP_001073352
NP_001273272
NP_067374
Локус (UCSC) Хр. 14: 99.17 – 99.27 Mb Хр. 12: 107.91 – 108 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

BCL11B (англ. B-cell CLL/lymphoma 11B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 894 амінокислот, а молекулярна маса — 95 519[4].

Послідовність амінокислот
1020304050
MSRRKQGNPQHLSQRELITPEADHVEAAILEEDEGLEIEEPSGLGLMVGG
PDPDLLTCGQCQMNFPLGDILVFIEHKRKQCGGSLGACYDKALDKDSPPP
SSRSELRKVSEPVEIGIQVTPDEDDHLLSPTKGICPKQENIAGPCRPAQL
PAVAPIAASSHPHSSVITSPLRALGALPPCLPLPCCSARPVSGDGTQGEG
QTEAPFGCQCQLSGKDEPSSYICTTCKQPFNSAWFLLQHAQNTHGFRIYL
EPGPASSSLTPRLTIPPPLGPEAVAQSPLMNFLGDSNPFNLLRMTGPILR
DHPGFGEGRLPGTPPLFSPPPRHHLDPHRLSAEEMGLVAQHPSAFDRVMR
LNPMAIDSPAMDFSRRLRELAGNSSTPPPVSPGRGNPMHRLLNPFQPSPK
SPFLSTPPLPPMPPGGTPPPQPPAKSKSCEFCGKTFKFQSNLIVHRRSHT
GEKPYKCQLCDHACSQASKLKRHMKTHMHKAGSLAGRSDDGLSAASSPEP
GTSELAGEGLKAADGDFRHHESDPSLGHEPEEEDEEEEEEEEELLLENES
RPESSFSMDSELSRNRENGGGGVPGVPGAGGGAAKALADEKALVLGKVME
NVGLGALPQYGELLADKQKRGAFLKRAAGGGDAGDDDDAGGCGDAGAGGA
VNGRGGGFAPGTEPFPGLFPRKPAPLPSPGLNSAAKRIKVEKDLELPPAA
LIPSENVYSQWLVGYAASRHFMKDPFLGFTDARQSPFATSSEHSSENGSL
RFSTPPGDLLDGGLSGRSGTASGGSTPHLGGPGPGRPSSKEGRRSDTCEY
CGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHGQIG
KEVYRCDICQMPFSVYSTLEKHMKKWHGEHLLTNDVKIEQAERS

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у ядрі.

Література[ред. | ред. код]

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13222 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q9C0K0 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]