ZBTB33

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZBTB33
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ZBTB33, ZNF-kaiso, ZNF348, zinc finger and BTB domain containing 33
Зовнішні ІД OMIM: 300329 MGI: 1927290 HomoloGene: 4931 GeneCards: ZBTB33
Шаблон експресії
PBB GE ZBTB33 214631 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006777
NM_001184742
NM_001079513
NM_020256
RefSeq (білок)
NP_001171671
NP_006768
NP_001072981
NP_064652
Локус (UCSC) Хр. X: 120.25 – 120.26 Mb Хр. X: 38.19 – 38.2 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZBTB33 (англ. Zinc finger and BTB domain containing 33) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[3] Довжина поліпептидного ланцюга білка становить 672 амінокислот, а молекулярна маса — 74 484[4].

Послідовність амінокислот
1020304050
MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHKNIL
SASSTYFHQLFSVAGQVVELSFIRAEIFAEILNYIYSSKIVRVRSDLLDE
LIKSGQLLGVKFIAELGVPLSQVKSISGTAQDGNTEPLPPDSGDKNLVIQ
KSKDEAQDNGATIMPIITESFSLSAEDYEMKKIIVTDSDDDDDDVIFCSE
ILPTKETLPSNNTVAQVQSNPGPVAISDVAPSASNNSPPLTNITPTQKLP
TPVNQATLSQTQGSEKLLVSSAPTHLTPNIILLNQTPLSTPPNVSSSLPN
HMPSSINLLVQNQQTPNSAILTGNKANEEEEEEIIDDDDDTISSSPDSAV
SNTSLVPQADTSQNTSFDGSLIQKMQIPTLLQEPLSNSLKISDIITRNTN
DPGVGSKHLMEGQKIITLDTATEIEGLSTGCKVYANIGEDTYDIVIPVKD
DPDEGEARLENEIPKTSGSEMANKRMKVKHDDHYELIVDGRVYYICIVCK
RSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRY
QCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYL
SDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQEND
SIFKQNVTDGSTEFEFIIPESY

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, сигнальний шлях Wnt. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Daniel J.M., Reynolds A.B. (1999). The catenin p120(ctn) interacts with Kaiso, a novel BTB/POZ domain zinc finger transcription factor.. Mol. Cell. Biol. 19: 3614 — 3623.  PubMed DOI:10.1128/MCB.19.5.3614
  • Yoon H.-G., Chan D.W., Reynolds A.B., Qin J., Wong J. (2003). N-CoR mediates DNA methylation-dependent repression through a methyl CpG binding protein Kaiso.. Mol. Cell 12: 723 — 734.  PubMed DOI:10.1016/j.molcel.2003.08.008
  • Kondapalli J., Flozak A.S., Albuquerque M.L.C. (2004). Laminar shear stress differentially modulates gene expression of p120 catenin, Kaiso transcription factor, and vascular endothelial cadherin in human coronary artery endothelial cells.. J. Biol. Chem. 279: 11417 — 11424.  PubMed DOI:10.1074/jbc.M306057200
  • Kelly K.F., Otchere A.A., Graham M., Daniel J.M. (2004). Nuclear import of the BTB/POZ transcriptional regulator Kaiso.. J. Cell Sci. 117: 6143 — 6152.  PubMed DOI:10.1242/jcs.01541

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:16682 (англ.). Процитовано 13 вересня 2017. 
  4. UniProt, Q86T24 (англ.). Процитовано 13 вересня 2017. 

Див. також[ред. | ред. код]