ELF2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ELF2
Ідентифікатори
Символи ELF2, EU32, NERF, NERF-1A, NERF-1B, NERF-1a,b, NERF-2, E74 like ETS transcription factor 2
Зовнішні ІД MGI: 1916507 HomoloGene: 5006 GeneCards: ELF2
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001291059
NM_001291062
NM_001291063
NM_023502
NM_001356358
RefSeq (білок)
NP_001277988
NP_001277991
NP_001277992
NP_075991
NP_001343287
Локус (UCSC) Хр. 4: 139.03 – 139.18 Mb Хр. 3: 51.25 – 51.34 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ELF2 (англ. E74 like ETS transcription factor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 593 амінокислот, а молекулярна маса — 63 967[4].

Послідовність амінокислот
1020304050
MTSAVVDSGGTILELSSNGVENQEESEKVSEYPAVIVEPVPSARLEQGYA
AQVLVYDDETYMMQDVAEEQEVETENVETVEASVHSSNAHCTDKTIEAAE
ALLHMESPTCLRDSRSPVEVFVPPCVSTPEFIHAAMRPDVITETVVEVST
EESEPMDTSPIPTSPDSHEPMKKKKVGRKPKTQQSPISNGSPELGIKKKP
REGKGNTTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLW
GKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKDMPKNIVVID
DDKSETCNEDLAGTTDEKSLERVSLSAESLLKAASSVRSGKNSSPINCSR
AEKGVARVVNITSPGHDASSRSPTTTASVSATAAPRTVRVAMQVPVVMTS
LGQKISTVAVQSVNAGAPLITSTSPTTATSPKVVIQTIPTVMPASTENGD
KITMQPAKIITIPATQLAQCQLQTKSNLTGSGSINIVGTPLAVRALTPVS
IAHGTPVMRLSMPTQQASGQTPPRVISAVIKGPEVKSEAVAKKQEHDVKT
LQLVEEKPADGNKTVTHVVVVSAPSAIALPVTMKTEGLVTCEK

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Mao S., Frank R.C., Zhang J., Miyazaki Y., Nimer S.D. (1999). Functional and physical interactions between AML1 proteins and an ETS protein, MEF: implications for the pathogenesis of t(8;21)-positive leukemias.. Mol. Cell. Biol. 19: 3635 — 3644.  PubMed DOI:10.1128/MCB.19.5.3635

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3317 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q15723 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]