ZNF44

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF44
Ідентифікатори
Символи ZNF44, GIOT-2, KOX7, ZNF, ZNF504, ZNF55, ZNF58, zinc finger protein 44
Зовнішні ІД OMIM: 194542 HomoloGene: 88837 GeneCards: ZNF44
Шаблон експресії
PBB GE ZNF44 206810 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
RefSeq (білок)
н/д
Локус (UCSC) Хр. 19: 12.22 – 12.29 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

ZNF44 (англ. Zinc finger protein 44) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 663 амінокислот, а молекулярна маса — 76 524[3].

Послідовність амінокислот
1020304050
MALCYGTFWGYPKMLEAANLMEGLVDIGPWVTLPRGQPEVLEWGLPKDQD
SVAFEDVAVNFTHEEWALLGPSQKNLYRDVMRETIRNLNCIGMKWENQNI
DDQHQNLRRNPRCDVVERFGKSKDGSQCGETLSQIRNSIVNKNTPARVDA
CGSSVNGEVIMGHSSLNCYIRVDTGHKHRECHEYAEKSYTHKQCGKGLSY
RHSFQTCERPHTGKKPYDCKECGKTFSSPGNLRRHMVVKGGDGPYKCELC
GKAFFWPSLLRMHERTHTGEKPYECKQCSKAFPVYSSYLRHEKIHTGEKP
YECKQCSKAFPDYSSYLRHERTHTGEKPYKCKQCGKAFSVSGSLRVHERI
HTGEKPYTCKQCGKAFCHLGSFQRHMIMHSGDGPHKCKICGKGFDFPGSA
RIHEGTHTLEKPYECKQCGKLLSHRSSFRRHMMAHTGDGPHKCTVCGKAF
DSPSVFQRHERTHTGEKPYECKQCGKAFRTSSSLRKHETTHTGEQPYKCK
CGKAFSDLFSFQSHETTHSEEEPYECKECGKAFSSFKYFCRHERTHSEEK
SYECQICGKAFSRFSYLKTHERTHTAEKPYECKQCRKAFFWPSFLLRHER
THTGERPYECKHCGKAFSRSSFCREHERTHTGEKPYECKECGKAFSSLSS
FNRHKRTHWKDIL

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Thiesen H.-J. (1990). Multiple genes encoding zinc finger domains are expressed in human T cells.. New Biol. 2: 363 — 374.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:13110 (англ.). Процитовано 12 вересня 2017. 
  3. UniProt, P15621 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]