SOX2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SOX2
Ідентифікатори
Символи SRY-box 2transcription factor SOX2transcription factor SOX-2SRY (sex determining region Y)-box 2sex determining region Y-box 2SOX2SRY-related HMG-box gene 2
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

SOX2 (англ. SRY-box 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 317 амінокислот, а молекулярна маса — 34 310[2].

Послідовність амінокислот
1020304050
MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMV
WSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRAL
HMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLG
AGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRY
DVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASS
SPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQS
GPVPGTAINGTLPLSHM

Кодований геном білок за функціями належить до активаторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Stevanovic M., Zuffardi O., Collignon J., Lovell-Badge R., Goodfellow P. (1994). The cDNA sequence and chromosomal location of the human SOX2 gene.. Mamm. Genome 5: 640 — 642.  PubMed DOI:10.1007/BF00411460
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:11195 (англ.). Процитовано 30 серпня 2017. 
  2. UniProt, P48431 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]