GTF2E2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GTF2E2
PDB 1d8k EBI.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GTF2E2, FE, TF2E2, TFIIE-B, TTD6, general transcription factor IIE subunit 2
Зовнішні ІД OMIM: 189964 MGI: 1915403 HomoloGene: 37573 GeneCards: GTF2E2
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002095
NM_001348353
NM_001167921
NM_001167922
NM_026584
RefSeq (білок)
NP_002086
NP_001335282
NP_001161393
NP_001161394
NP_080860
Локус (UCSC) Хр. 8: 30.58 – 30.66 Mb Хр. 8: 33.73 – 33.78 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GTF2E2 (англ. General transcription factor IIE subunit 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 291 амінокислот, а молекулярна маса — 33 044[4].

Послідовність амінокислот
1020304050
MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSG
SKQNSDHSNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLD
EILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVRDKKA
LLRLLDQHDQRGLGGILLEDIEEALPNSQKAVKALGDQILFVNRPDKKKI
LFFNDKSCQFSVDEEFQKLWRSVTVDSMDEEKIEEYLKRQGISSMQESGP
KKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kang S.-W., Kuzuhara T., Horikoshi M. (2000). Functional interaction of general transcription initiation factor TFIIE with general chromatin factor SPT16/CDC68.. Genes Cells 5: 251 — 263.  PubMed DOI:10.1046/j.1365-2443.2000.00323.x

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4651 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, P29084 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]