ARID1B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ARID1B
Protein ARID1B PDB 2cxy.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ARID1B, 6A3-5, BAF250B, BRIGHT, DAN15, ELD/OSA1, MRD12, OSA2, P250R, CSS1, AT-rich interaction domain 1B
Зовнішні ІД OMIM: 614556 MGI: 1926129 HomoloGene: 32344 GeneCards: ARID1B
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_017519
NM_020732
NM_001346813
NM_001363725
NM_001085355
RefSeq (білок)
NP_001333742
NP_059989
NP_065783
NP_001350654
NP_001078824
Локус (UCSC) Хр. 6: 156.78 – 157.21 Mb Хр. 17: 4.99 – 5.35 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ARID1B (англ. AT-rich interaction domain 1B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 2 236 амінокислот, а молекулярна маса — 236 123[4].

Послідовність амінокислот
1020304050
MAHNAGAAAAAGTHSAKSGGSEAALKEGGSAAALSSSSSSSAAAAAASSS
SSSGPGSAMETGLLPNHKLKTVGEAPAAPPHQQHHHHHHAHHHHHHAHHL
HHHHALQQQLNQFQQQQQQQQQQQQQQQQQQHPISNNNSLGGAGGGAPQP
GPDMEQPQHGGAKDSAAGGQADPPGPPLLSKPGDEDDAPPKMGEPAGGRY
EHPGLGALGTQQPPVAVPGGGGGPAAVPEFNNYYGSAAPASGGPGGRAGP
CFDQHGGQQSPGMGMMHSASAAAAGAPGSMDPLQNSHEGYPNSQCNHYPG
YSRPGAGGGGGGGGGGGGGSGGGGGGGGAGAGGAGAGAVAAAAAAAAAAA
GGGGGGGYGGSSAGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAGSAAG
GFQRFAGQNQHPSGATPTLNQLLTSPSPMMRSYGGSYPEYSSPSAPPPPP
SQPQSQAAAAGAAAGGQQAAAGMGLGKDMGAQYAAASPAWAAAQQRSHPA
MSPGTPGPTMGRSQGSPMDPMVMKRPQLYGMGSNPHSQPQQSSPYPGGSY
GPPGPQRYPIGIQGRTPGAMAGMQYPQQQMPPQYGQQGVSGYCQQGQQPY
YSQQPQPPHLPPQAQYLPSQSQQRYQPQQDMSQEGYGTRSQPPLAPGKPN
HEDLNLIQQERPSSLPDLSGSIDDLPTGTEATLSSAVSASGSTSSQGDQS
NPAQSPFSPHASPHLSSIPGGPSPSPVGSPVGSNQSRSGPISPASIPGSQ
MPPQPPGSQSESSSHPALSQSPMPQERGFMAGTQRNPQMAQYGPQQTGPS
MSPHPSPGGQMHAGISSFQQSNSSGTYGPQMSQYGPQGNYSRPPAYSGVP
SASYSGPGPGMGISANNQMHGQGPSQPCGAVPLGRMPSAGMQNRPFPGNM
SSMTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQSRQGS
FPGMNQSGLMASSSPYSQPMNNSSSLMNTQAPPYSMAPAMVNSSAASVGL
ADMMSPGESKLPLPLKADGKEEGTPQPESKSKKSSSSTTTGEKITKVYEL
GNEPERKLWVDRYLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGL
AQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKIERGEEPP
PEVFSTGDTKKQPKLQPPSPANSGSLQGPQTPQSTGSNSMAEVPGDLKPP
TPASTPHGQMTPMQGGRSSTISVHDPFSDVSDSSFPKRNSMTPNAPYQQG
MSMPDVMGRMPYEPNKDPFGGMRKVPGSSEPFMTQGQMPNSSMQDMYNQS
PSGAMSNLGMGQRQQFPYGASYDRRHEPYGQQYPGQGPPSGQPPYGGHQP
GLYPQQPNYKRHMDGMYGPPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSG
PDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQN
MWAARNDMPYPYQNRQGPGGPTQAPPYPGMNRTDDMMVPDQRINHESQWP
SHVSQRQPYMSSSASMQPITRPPQPSYQTPPSLPNHISRAPSPASFQRSL
ENRMSPSKSPFLPSMKMQKVMPTVPTSQVTGPPPQPPPIRREITFPPGSV
EASQPVLKQRRKITSKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLY
DDSTVATFNLSQLSGFLELLVEYFRKCLIDIFGILMEYEVGDPSQKALDH
NAARKDDSQSLADDSGKEEEDAECIDDDEEDEEDEEEDSEKTESDEKSSI
ALTAPDAAADPKEKPKQASKFDKLPIKIVKKNNLFVVDRSDKLGRVQEFN
SGLLHWQLGGGDTTEHIQTHFESKMEIPPRRRPPPPLSSAGRKKEQEGKG
DSEEQQEKSIIATIDDVLSARPGALPEDANPGPQTESSKFPFGIQQAKSH
RNIKLLEDEPRSRDETPLCTIAHWQDSLAKRCICVSNIVRSLSFVPGNDA
EMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWW
WDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLLHWMVCPSAEA
QDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATPPFSRQEKFYA
TLVRYVGDRKNPVCREMSMALLSNLAQGDALAARAIAVQKGSIGNLISFL
EDGVTMAQYQQSQHNLMHMQPPPLEPPSVDMMCRAAKALLAMARVDENRS
EFLLHEGRLLDISISAVLNSLVASVICDVLFQIGQL

Кодований геном білок за функціями належить до регуляторів хроматину, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, нейрогенез, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Mangel L., Ternes T., Schmitz B., Doerfler W. (1998). New 5'-(CGG)-3' repeats in the human genome.. J. Biol. Chem. 273: 30466 — 30471.  PubMed DOI:10.1074/jbc.273.46.30466
  • Martens J.A., Winston F. (2003). Recent advances in understanding chromatin remodeling by SWI/SNF complexes.. Curr. Opin. Genet. Dev. 13: 136 — 142.  PubMed DOI:10.1016/S0959-437X(03)00022-4
  • Hurlstone A.F., Olave I.A., Barker N., van Noort M., Clevers H. (2002). Cloning and characterization of hELD/OSA1, a novel BRG1 interacting protein.. Biochem. J. 364: 255 — 264.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:18040 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, Q8NFD5 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]