PHOX2B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PHOX2B
Ідентифікатори
Символи PHOX2B, NBLST2, NBPhox, PMX2B, paired like homeobox 2b, CCHS
Зовнішні ІД OMIM: 603851 MGI: 1100882 HomoloGene: 68371 GeneCards: PHOX2B
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003924
NM_008888
RefSeq (білок)
NP_003915
NP_032914
Локус (UCSC) Хр. 4: 41.74 – 41.75 Mb Хр. 5: 67.09 – 67.1 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PHOX2B (англ. Paired like homeobox 2b) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 314 амінокислот, а молекулярна маса — 31 621[4].

Послідовність амінокислот
1020304050
MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTT
FGATSGCPSLTPGSCSLGTLRDHQSSPYAAVPYKLFTDHGGLNEKRKQRR
IRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRR
AKFRKQERAAAAAAAAAKNGSSGKKSDSSRDDESKEAKSTDPDSTGGPGP
NPNPTPSCGANGGGGGGPSPAGAPGAAGPGGPGGEPGKGGAAAAAAAAAA
AAAAAAAAAAGGLAAAGGPGQGWAPGPGPITSIPDSLGGPFASVLSSLQR
PNGAKAALVKSSMF

Кодований геном білок за функціями належить до активаторів, білків розвитку. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Yokoyama M., Nishi Y., Yoshii J., Okubo K., Matsubara K. (1996). Identification and cloning of neuroblastoma-specific and nerve tissue-specific genes through compiled expression profiles.. DNA Res. 3: 311 — 320.  PubMed DOI:10.1093/dnares/3.5.311
  • Adachi M., Browne D., Lewis E.J. (2000). Paired-like homeodomain proteins Phox2a/Arix and Phox2b/NBPhox have similar genetic organization and independently regulate dopamine beta-hydroxylase gene transcription.. DNA Cell Biol. 19: 539 — 554.  PubMed DOI:10.1089/104454900439773
  • Yokoyama M., Watanabe H., Nakamura M. (1999). Genomic structure and functional characterization of NBPhox (PMX2B), a homeodomain protein specific to catecholaminergic cells that is involved in second messenger-mediated transcriptional activation.. Genomics 59: 40 — 50.  PubMed DOI:10.1006/geno.1999.5845
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • McConville C., Reid S., Baskcomb L., Douglas J., Rahman N. (2006). PHOX2B analysis in non-syndromic neuroblastoma cases shows novel mutations and genotype-phenotype associations.. Am. J. Med. Genet. A 140: 1297 — 1301.  PubMed DOI:10.1002/ajmg.a.31278

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9143 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q99453 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]