RUNX1T1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RUNX1T1
Protein RUNX1T1 PDB 1wq6.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RUNX1T1, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2, AML1-MTG8, t(8;21)(q22;q22), RUNX1 translocation partner 1, RUNX1 partner transcriptional co-repressor 1
Зовнішні ІД OMIM: 133435 MGI: 104793 HomoloGene: 3801 GeneCards: RUNX1T1
Шаблон експресії
PBB GE RUNX1T1 205529 s at fs.png

PBB GE RUNX1T1 205528 s at fs.png

PBB GE RUNX1T1 216831 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001111026
NM_001111027
NM_009822
RefSeq (білок)
NP_001104496
NP_001104497
NP_033952
Локус (UCSC) Хр. 8: 91.95 – 92.1 Mb Хр. 4: 13.74 – 13.89 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RUNX1T1 (англ. RUNX1 translocation partner 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 604 амінокислот, а молекулярна маса — 67 566[4].

Послідовність амінокислот
1020304050
MISVKRNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSR
LTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNG
PSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRT
LVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCA
RLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKE
NGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHY
RLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREW
AEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAE
DLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAE
EAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAED
ALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHI
CGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIE
TTPR

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Wolford J.K., Prochazka M. (1998). Structure and expression of the human MTG8/ETO gene.. Gene 212: 103 — 109.  PubMed DOI:10.1016/S0378-1119(98)00141-3
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Davis J.N., McGhee L., Meyers S. (2003). The ETO (MTG8) gene family.. Gene 303: 1 — 10.  PubMed DOI:10.1016/S0378-1119(02)01172-1
  • Rossetti S., Hoogeveen A.T., Sacchi N. (2004). The MTG proteins: chromatin repression players with a passion for networking.. Genomics 84: 1 — 9.  PubMed DOI:10.1016/j.ygeno.2004.02.011
  • Kwok C., Zeisig B.B., Qiu J., Dong S., So C.W. (2009). Transforming activity of AML1-ETO is independent of CBFbeta and ETO interaction but requires formation of homo-oligomeric complexes.. Proc. Natl. Acad. Sci. U.S.A. 106: 2853 — 2858.  PubMed DOI:10.1073/pnas.0810558106
  • Plevin M.J., Zhang J., Guo C., Roeder R.G., Ikura M. (2006). The acute myeloid leukemia fusion protein AML1-ETO targets E proteins via a paired amphipathic helix-like TBP-associated factor homology domain.. Proc. Natl. Acad. Sci. U.S.A. 103: 10242 — 10247.  PubMed DOI:10.1073/pnas.0603463103

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1535 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, Q06455 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]