ZNF219

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF219
Ідентифікатори
Символи ZNF219, ZFP219, zinc finger protein 219
Зовнішні ІД OMIM: 605036 MGI: 1917140 HomoloGene: 9504 GeneCards: ZNF219
Шаблон експресії
PBB GE ZNF219 219314 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001101672
NM_001102454
NM_016423
NM_001253694
NM_001253695
NM_001253696
NM_027248
RefSeq (білок)
NP_001095142
NP_001095924
NP_057507
NP_001240623
NP_001240624
NP_001240625
NP_081524
Локус (UCSC) Хр. 14: 21.09 – 21.1 Mb Хр. 14: 52.01 – 52.02 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF219 (англ. Zinc finger protein 219) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 722 амінокислот, а молекулярна маса — 76 877[4].

Послідовність амінокислот
1020304050
MEGSRPRAPSGHLAPSPPAFDGELDLQRYSNGPAVSAGSLGMGAVSWSES
RAGERRFPCPVCGKRFRFNSILALHLRAHPGAQAFQCPHCGHRAAQRALL
RSHLRTHQPERPRSPAARLLLELEERALLREARLGRARSSGGMQATPATE
GLARPQAPSSSAFRCPYCKGKFRTSAERERHLHILHRPWKCGLCSFGSSQ
EEELLHHSLTAHGAPERPLAATSAAPPPQPQPQPPPQPEPRSVPQPEPEP
EPEREATPTPAPAAPEEPPAPPEFRCQVCGQSFTQSWFLKGHMRKHKASF
DHACPVCGRCFKEPWFLKNHMKVHASKLGPLRAPGPASGPARAPQPPDLG
LLAYEPLGPALLLAPAPTPAERREPPSLLGYLSLRAGEGRPNGEGAEPGP
GRSFGGFRPLSSALPARARRHRAEEPEEEEEVVEAEEETWARGRSLGSLA
SLHPRPGEGPGHSASAAGAQARSTATQEENGLLVGGTRPEGGRGATGKDC
PFCGKSFRSAHHLKVHLRVHTGERPYKCPHCDYAGTQSGSLKYHLQRHHR
EQRSGAGPGPPPEPPPPSQRGSAPQSGAKPSPQPATWVEGASSPRPPSSG
AGPGSRRKPASPGRTLRNGRGGEAEPLDLSLRAGPGGEAGPGGALHRCLF
CPFATGAPELMALHLQVHHSRRARGRRPPQADASPPYARVPSGETPPSPS
QEGEEGSGLSRPGEAGLGGQER

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Sakai T., Toyoda A., Hashimoto K., Maeda H. (2000). Isolation and characterization of a novel zinc finger gene, ZNF219, and mapping to the human chromosome 14q11 region.. DNA Res. 7: 137 — 141.  PubMed DOI:10.1093/dnares/7.2.137
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13011 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q9P2Y4 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]