FHL2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FHL2
Protein FHL2 PDB 1x4k.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи FHL2, AAG11, DRAL, FHL-2, SLIM-3, SLIM3, four and a half LIM domains 2
Зовнішні ІД OMIM: 602633 MGI: 1338762 HomoloGene: 20372 GeneCards: FHL2
Шаблон експресії
PBB GE FHL2 202949 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001289533
NM_010212
RefSeq (білок)
NP_001276462
NP_034342
Локус (UCSC) Хр. 2: 105.36 – 105.44 Mb Хр. 1: 43.12 – 43.2 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FHL2 (англ. Four and a half LIM domains 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 279 амінокислот, а молекулярна маса — 32 193[4].

Послідовність амінокислот
1020304050
MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCD
CKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSK
CQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFC
VPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRF
TARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFN
CKKCSLSLVGRGFLTERDDILCPDCGKDI

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Tanahashi H., Tabira T. (2000). Alzheimer's disease-associated presenilin 2 interacts with DRAL, an LIM-domain protein.. Hum. Mol. Genet. 9: 2281 — 2289.  PubMed DOI:10.1093/oxfordjournals.hmg.a018919
  • Takahashi K., Matsumoto C., Ra C. (2005). FHL3 negatively regulates human high-affinity IgE receptor beta-chain gene expression by acting as a transcriptional co-repressor of MZF-1.. Biochem. J. 386: 191 — 200.  PubMed DOI:10.1042/BJ20040775
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Morgan M.J., Madgwick A.J.A. (1996). Slim defines a novel family of LIM-proteins expressed in skeletal muscle.. Biochem. Biophys. Res. Commun. 225: 632 — 638.  PubMed DOI:10.1006/bbrc.1996.1222
  • Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. (2005). Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation.. EMBO J. 24: 1021 — 1032.  PubMed DOI:10.1038/sj.emboj.7600570

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3703 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q14192 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]