EHF

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
EHF
Ідентифікатори
Символи EHF, ESE3, ESE3B, ESEJ, ETS homologous factor
Зовнішні ІД OMIM: 605439 MGI: 1270840 HomoloGene: 7301 GeneCards: EHF
Пов'язані генетичні захворювання
Ожиріння[1]
Шаблон експресії
PBB GE EHF 219850 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001206615
NM_001206616
NM_012153
NM_007914
RefSeq (білок)
NP_001193544
NP_001193545
NP_036285
NP_031940
Локус (UCSC) Хр. 11: 34.62 – 34.66 Mb Хр. 2: 103.26 – 103.3 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

EHF (англ. ETS homologous factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 300 амінокислот, а молекулярна маса — 34 892[5].

Послідовність амінокислот
1020304050
MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYW
TKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTA
GQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIMNTWKDENYLY
DTNYGSTVDLLDSKTFCRAQISMTTTSHLPVAESPDMKKEQDPPAKCHTK
KHNPRGTHLWEFIRDILLNPDKNPGLIKWEDRSEGVFRFLKSEAVAQLWG
KKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lim J.H., Cho J.-Y., Park Y.B., Park J.-W., Kwon T.K. (2006). ESE-3 transcription factor is involved in the expression of death receptor (DR)-5 through putative Ets sites.. Biochem. Biophys. Res. Commun. 350: 736 — 741.  PubMed DOI:10.1016/j.bbrc.2006.09.102

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]