HEY1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HEY1
Protein HEY1 PDB 2db7.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HEY1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, OAF1, hHRT1, hes related family bHLH transcription factor with YRPW motif 1, NERP2
Зовнішні ІД OMIM: 602953 MGI: 1341800 HomoloGene: 7756 GeneCards: HEY1
Шаблон експресії
PBB GE HEY1 44783 s at fs.png

PBB GE HEY1 218839 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_012258
NM_001040708
NM_001282851
NM_010423
RefSeq (білок)
NP_001035798
NP_001269780
NP_036390
NP_034553
Локус (UCSC) Хр. 8: 79.76 – 79.77 Mb Хр. 3: 8.66 – 8.67 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HEY1 (англ. Hes related family bHLH transcription factor with YRPW motif 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 304 амінокислот, а молекулярна маса — 32 613[4].

Послідовність амінокислот
1020304050
MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILAR
KRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDH
LKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPL
RVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNG
HGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKL
SPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRPWGTE
IGAF

Кодований геном білок за функціями належить до репресорів, білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Kokubo H., Lun Y., Johnson R.L. (1999). Identification and expression of a novel family of bHLH cDNAs related to Drosophila hairy and enhancer of split.. Biochem. Biophys. Res. Commun. 260: 459 — 465.  PubMed DOI:10.1006/bbrc.1999.0880
  • Leimeister C., Externbrinck A., Klamt B., Gessler M. (1999). Hey genes: a novel subfamily of hairy- and enhancer of split related genes specifically expressed during mouse embryogenesis.. Mech. Dev. 85: 173 — 177.  PubMed DOI:10.1016/S0925-4773(99)00080-5
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4880 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, Q9Y5J3 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]