HMGN3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HMGN3
Ідентифікатори
Символи HMGN3, PNAS-25, TRIP7, PNAS-24, high mobility group nucleosomal binding domain 3
Зовнішні ІД OMIM: 604502 HomoloGene: 130417 GeneCards: HMGN3
Шаблон експресії
PBB GE HMGN3 209377 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001007020
NM_001201353
NM_001201354
NM_001201355
RefSeq (білок)
NP_001007021
NP_001188282
NP_001188283
NP_001188284
Локус (UCSC) Хр. 6: 79.2 – 79.23 Mb н/д
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HMGN3 (англ. High mobility group nucleosomal binding domain 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 99 амінокислот, а молекулярна маса — 10 666[4].

Послідовність амінокислот
1020304050
MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKK
EPGAKISRGAKGKKEEKQEAGKEGTAPSENGETKAEEAQKTESVDNEGE

Кодований геном білок за функціями належить до регуляторів хроматину, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Lee J.W., Choi H.-S., Gyuris J., Brent R., Moore D.D. (1995). Two classes of proteins dependent on either the presence or absence of thyroid hormone for interaction with the thyroid hormone receptor.. Mol. Endocrinol. 9: 243 — 254.  PubMed DOI:10.1210/mend.9.2.7776974
  • Leong P.W., Liew K., Lim W., Chow V.T.K. (2002). Differential display RT-PCR analysis of enterovirus-71-infected rhabdomyosarcoma cells reveals mRNA expression responses of multiple human genes with known and novel functions.. Virology 295: 147 — 159.  PubMed DOI:10.1006/viro.2002.1353
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:12312 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, Q15651 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]