TBP

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TBP
Protein TBP PDB 1c9b.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TBP, GTF2D, GTF2D1, HDL4, SCA17, TFIID, TATA-box binding protein, TATA-binding protein
Зовнішні ІД OMIM: 600075 MGI: 101838 HomoloGene: 2404 GeneCards: TBP
Пов'язані генетичні захворювання
spinocerebellar ataxia type 17[1]
Шаблон експресії
PBB GE TBP 203135 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003194
NM_001172085
NM_013684
RefSeq (білок)
NP_001165556
NP_003185
NP_038712
Локус (UCSC) Хр. 6: 170.55 – 170.57 Mb Хр. 17: 15.5 – 15.53 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TBP (англ. TATA-box binding protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 339 амінокислот, а молекулярна маса — 37 698[5].

Послідовність амінокислот
1020304050
MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLS
ILEEQQRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAVAAA
AVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPIT
PATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAV
IMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKF
LDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRI
VLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT

Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Peterson M.G., Tanese N., Pugh B.F., Tjian R. (1990). Functional domains and upstream activation properties of cloned human TATA binding protein.. Science 248: 1625 — 1630.  PubMed DOI:10.1126/science.2363050
  • Geisberg J.V., Lee W.S., Berk A.J., Ricciardi R.P. (1994). The zinc finger region of the adenovirus E1A transactivating domain complexes with the TATA box binding protein.. Proc. Natl. Acad. Sci. U.S.A. 91: 2488 — 2492.  PubMed DOI:10.1073/pnas.91.7.2488
  • Veschambre P., Simard P., Jalinot P. (1995). Evidence for functional interaction between the HIV-1 Tat transactivator and the TATA box binding protein in vivo.. J. Mol. Biol. 250: 169 — 180.  PubMed DOI:10.1006/jmbi.1995.0368
  • LeRoy G., Orphanides G., Lane W.S., Reinberg D. (1998). Requirement of RSF and FACT for transcription of chromatin templates in vitro.. Science 282: 1900 — 1904.  PubMed DOI:10.1126/science.282.5395.1900
  • Yuan C.X., Gurley W.B. (2000). Potential targets for HSF1 within the preinitiation complex.. Cell Stress Chaperones 5: 229 — 242.  PubMed DOI:10.1379/1466-1268(2000)005<0229:PTFHWT>2.0.CO;2
  • Friedrich J.K., Panov K.I., Cabart P., Russell J., Zomerdijk J.C.B.M. (2005). TBP-TAF complex SL1 directs RNA polymerase I pre-initiation complex formation and stabilizes upstream binding factor at the rDNA promoter.. J. Biol. Chem. 280: 29551 — 29558.  PubMed DOI:10.1074/jbc.M501595200

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]