MEOX2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MEOX2
Ідентифікатори
Символи MEOX2, GAX, MOX2, mesenchyme homeobox 2
Зовнішні ІД OMIM: 600535 MGI: 103219 HomoloGene: 4330 GeneCards: MEOX2
Шаблон експресії
PBB GE MEOX2 206201 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005924
NM_008584
RefSeq (білок)
NP_005915
NP_032610
Локус (UCSC) Хр. 7: 15.61 – 15.69 Mb Хр. 12: 37.11 – 37.18 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MEOX2 (англ. Mesenchyme homeobox 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 304 амінокислот, а молекулярна маса — 33 594[4].

Послідовність амінокислот
1020304050
MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCII
AGYPNEEGMFASQHHRGHHHHHHHHHHHHHQQQQHQALQTNWHLPQMSSP
PSAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGAACAPGDYG
RQALSPAEAEKRSGGKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIR
ELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQ
GAAAREKELVNVKKGTLLPSELSGIGAATLQQTGDSIANEDSHDSDHSSE
HAHL

Кодований геном білок за функціями належить до активаторів, білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Lepage D.F., Walsh K. (1994). Molecular cloning and localization of the human GAX gene to 7p21.. Genomics 24: 535 — 540.  PubMed DOI:10.1006/geno.1994.1663
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Salichs E., Ledda A., Mularoni L., Alba M.M., de la Luna S. (2009). Genome-wide analysis of histidine repeats reveals their role in the localization of human proteins to the nuclear speckles compartment.. PLoS Genet. 5: E1000397 — E1000397.  PubMed DOI:10.1371/journal.pgen.1000397
  • Douville J.M., Cheung D.Y., Herbert K.L., Moffatt T., Wigle J.T. (2011). Mechanisms of MEOX1 and MEOX2 regulation of the cyclin dependent kinase inhibitors p21 and p16 in vascular endothelial cells.. PLoS ONE 6: E29099 — E29099.  PubMed DOI:10.1371/journal.pone.0029099

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7014 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, P50222 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]