RORC

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RORC
RORC 3L0L.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RORC, NR1F3, RORG, RZR-GAMMA, RZRG, TOR, RAR-related orphan receptor gamma, IMD42, RAR related orphan receptor C
Зовнішні ІД OMIM: 602943 MGI: 104856 HomoloGene: 21051 GeneCards: RORC
Пов'язані генетичні захворювання
inflammatory bowel disease[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001001523
NM_005060
NM_001293734
NM_011281
RefSeq (білок)
NP_001001523
NP_005051
NP_001280663
NP_035411
Локус (UCSC) Хр. 1: 151.81 – 151.83 Mb Хр. 3: 94.37 – 94.4 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RORC (англ. RAR related orphan receptor C) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 518 амінокислот, а молекулярна маса — 58 195[5].

Послідовність амінокислот
1020304050
MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEG
CKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDA
VKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYT
LGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASC
HLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDS
YGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIF
SREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQI
VLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSI
FDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAF
HHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPP
LYKELFSTETESPVGLSK

Кодований геном білок за функціями належить до рецепторів, активаторів, білків розвитку. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, біологічні ритми. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Hirose T., Smith R.J., Jetten A.M. (1994). ROR gamma: the third member of ROR/RZR orphan receptor subfamily that is highly expressed in skeletal muscle.. Biochem. Biophys. Res. Commun. 205: 1976 — 1983.  PubMed DOI:10.1006/bbrc.1994.2902
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Jetten A.M. (2009). Retinoid-related orphan receptors (RORs): critical roles in development, immunity, circadian rhythm, and cellular metabolism.. Nucl. Recept. Signal. 7: 3 — 35.  PubMed DOI:10.1621/nrs.07003
  • Wang Y., Kumar N., Crumbley C., Griffin P.R., Burris T.P. (2010). A second class of nuclear receptors for oxysterols: Regulation of RORalpha and RORgamma activity by 24S-hydroxycholesterol (cerebrosterol).. Biochim. Biophys. Acta 1801: 917 — 923.  PubMed DOI:10.1016/j.bbalip.2010.02.012
  • Solt L.A., Burris T.P. (2012). Action of RORs and their ligands in (patho)physiology.. Trends Endocrinol. Metab. 23: 619 — 627.  PubMed DOI:10.1016/j.tem.2012.05.012

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]