MTA3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MTA3
Protein MTA3 PDB 2crg.png
Ідентифікатори
Символи MTA3, metastasis associated 1 family member 3
Зовнішні ІД OMIM: 609050 MGI: 2151172 HomoloGene: 14282 GeneCards: MTA3
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001171052
NM_001171053
NM_001171054
NM_054082
RefSeq (білок)
NP_001164523
NP_001164524
NP_001164525
NP_473423
Локус (UCSC) Хр. 2: 42.49 – 42.76 Mb Хр. 17: 83.71 – 83.82 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MTA3 (англ. Metastasis associated 1 family member 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 594 амінокислот, а молекулярна маса — 67 504[4].

Послідовність амінокислот
1020304050
MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRD
ISNTLIMLADKHAKEIEEESETTVEADLTDKQKHQLKHRELFLSRQYESL
PATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSLKTLLADKGEI
RVGPRYQADIPEMLLEGESDEREQSKLEVKVWDPNSPLTDRQIDQFLVVA
RAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHSYDLSS
AISVLVPLGGPVLCRDEMEEWSASEASLFEEALEKYGKDFNDIRQDFLPW
KSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYSKPNPNQI
STSNGKPGAVNGAVGTTFQPQNPLLGRACESCYATQSHQWYSWGPPNMQC
RLCAICWLYWKKYGGLKMPTQSEEEKLSPSPTTEDPRVRSHVSRQAMQGM
PVRNTGSPKSAVKTRQAFFLHTTYFTKFARQVCKNTLRLRQAARRPFVAI
NYAAIRAEYADRHAELSGSPLKSKSTRKPLACIIGYLEIHPAKKPNVIRS
TPSLQTPTTKRMLTTPNHTSLSILGKRNYSHHNGLDELTCCVSD

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі як альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:23784 (англ.). Процитовано 29 серпня 2017. 
  4. UniProt, Q9BTC8 (англ.). Процитовано 29 серпня 2017. 

Див. також[ред. | ред. код]