ESRRB

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ESRRB
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ESRRB, DFNB35, ERR2, ERRb, ESRL2, NR3B2, estrogen related receptor beta
Зовнішні ІД OMIM: 602167 MGI: 1346832 HomoloGene: 69108 GeneCards: ESRRB
Пов'язані генетичні захворювання
autosomal recessive nonsyndromic deafness 35, nonsyndromic deafness[1]
Реагує на сполуку
biochanin A, daidzein, Геністейн, diethylstilbestrol[2]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004452
NM_001159500
NM_011934
RefSeq (білок)
NP_004443
NP_001152972
NP_036064
Локус (UCSC) Хр. 14: 76.31 – 76.5 Mb Хр. 12: 86.36 – 86.52 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ESRRB (англ. Estrogen related receptor beta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 433 амінокислот, а молекулярна маса — 48 054[6].

Послідовність амінокислот
1020304050
MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALG
THANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDSAIKCEYMLNAIPK
RLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKR
RRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSESSPYLSLQ
ISPPAKKPLTKIVSYLLVAEPDKLYAMPPPGMPEGDIKALTTLCDLADRE
LVVIIGWAKHIPGFSSLSLGDQMSLLQSAWMEILILGIVYRSLPYDDKLV
YAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALA
NSDSMYIEDLEAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLR
QTAAKAVQHFYSVKLQGKVPMHKLFLEMLEAKV

Кодований геном білок за функцією належить до рецепторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі, хромосомах.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Zhou W., Lo S.C., Liu J.H., Hannink M., Lubahn D.B. (2007). ERRbeta: a potent inhibitor of Nrf2 transcriptional activity.. Mol. Cell. Endocrinol. 278: 52 — 62.  PubMed DOI:10.1016/j.mce.2007.08.011
  • Bombail V., Collins F., Brown P., Saunders P.T. (2010). Modulation of ER alpha transcriptional activity by the orphan nuclear receptor ERR beta and evidence for differential effects of long- and short-form splice variants.. Mol. Cell. Endocrinol. 314: 53 — 61.  PubMed DOI:10.1016/j.mce.2009.09.007
  • Cho Y., Hazen B.C., Russell A.P., Kralli A. (2013). Peroxisome proliferator-activated receptor gamma coactivator 1 (PGC-1)- and estrogen-related receptor (ERR)-induced regulator in muscle 1 (Perm1) is a tissue-specific regulator of oxidative capacity in skeletal muscle cells.. J. Biol. Chem. 288: 25207 — 25218.  PubMed DOI:10.1074/jbc.M113.489674
  • Bombail V., MacPherson S., Critchley H.O., Saunders P.T. (2008). Estrogen receptor related beta is expressed in human endometrium throughout the normal menstrual cycle.. Hum. Reprod. 23: 2782 — 2790.  PubMed DOI:10.1093/humrep/den298
  • Wilson B.J., Tremblay A.M., Deblois G., Sylvain-Drolet G., Giguere V. (2010). An acetylation switch modulates the transcriptional activity of estrogen-related receptor alpha.. Mol. Endocrinol. 24: 1349 — 1358.  PubMed DOI:10.1210/me.2009-0441

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]