BCL11A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
BCL11A
Ідентифікатори
Символи BCL11A, BCL11A-L, BCL11A-S, BCL11A-XL, BCL11a-M, CTIP1, EVI9, HBFQTL5, ZNF856, B-cell CLL/lymphoma 11A, DILOS, B cell CLL/lymphoma 11A, BAF complex component, BAF chromatin remodeling complex subunit BCL11A
Зовнішні ІД OMIM: 606557 MGI: 106190 HomoloGene: 11284 GeneCards: BCL11A
Пов'язані генетичні захворювання
Серповидноклітинна анемія, Синдром порушення активності та уваги, Hemoglobin E, beta thalassemia[1]
Шаблон експресії
PBB GE BCL11A 219498 s at fs.png

PBB GE BCL11A 210347 s at fs.png

PBB GE BCL11A 219497 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001159289
NM_001159290
NM_001242934
NM_016707
RefSeq (білок)
NP_060484
NP_075044
NP_612569
NP_001350793
NP_001352538
NP_001152761
NP_001152762
NP_001229863
NP_057916
Локус (UCSC) Хр. 2: 60.45 – 60.55 Mb Хр. 11: 24.08 – 24.17 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

BCL11A (англ. B-cell CLL/lymphoma 11A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 835 амінокислот, а молекулярна маса — 91 197[5].

Послідовність амінокислот
1020304050
MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQ
CQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPSPIEMKKASNPVE
VGIQVTPEDDDCLSTSSRGICPKQEHIADKLLHWRGLSSPRSAHGALIPT
PGMSAEYAPQGICKDEPSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLE
SEHGSPLTPRVGIPSGLGAECPSQPPLHGIHIADNNPFNLLRIPGSVSRE
ASGLAEGRFPPTPPLFSPPPRHHLDPHRIERLGAEEMALATHHPSAFDRV
LRLNPMAMEPPAMDFSRRLRELAGNTSSPPLSPGRPSPMQRLLQPFQPGS
KPPFLATPPLPPLQSAPPPSQPPVKSKSCEFCGKTFKFQSNLVVHRRSHT
GEKPYKCNLCDHACTQASKLKRHMKTHMHKSSPMTVKSDDGLSTASSPEP
GTSDLVGSASSALKSVVAKFKSENDPNLIPENGDEEEEEDDEEEEEEEEE
EEEELTESERVDYGFGLSLEAARHHENSSRGAVVGVGDESRALPDVMQGM
VLSSMQHFSEAFHQVLGEKHKRGHLAEAEGHRDTCDEDSVAGESDRIDDG
TVNGRGCSPGESASGGLSKKLLLGSPSSLSPFSKRIKLEKEFDLPPAAMP
NTENVYSQWLAGYAASRQLKDPFLSFGDSRQSPFASSSEHSSENGSLRFS
TPPGELDGGISGRSGTGSGGSTPHISGPGPGRPSSKEGRRSDTCEYCGKV
FKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHGQVGKDVY
KCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Saiki Y., Yamazaki Y., Yoshida M., Katoh O., Nakamura T. (2000). Human EVI9, a homologue of the mouse myeloid leukemia gene, is expressed in the hematopoietic progenitors and down-regulated during myeloid differentiation of HL60 cells.. Genomics 70: 387 — 391.  PubMed DOI:10.1006/geno.2000.6385
  • Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O. (2001). Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.. DNA Res. 8: 85 — 95.  PubMed DOI:10.1093/dnares/8.2.85
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bauer D.E., Orkin S.H. (2015). Hemoglobin switching's surprise: the versatile transcription factor BCL11A is a master repressor of fetal hemoglobin.. Curr. Opin. Genet. Dev. 33: 62 — 70.  PubMed DOI:10.1016/j.gde.2015.08.001

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]