GTF2F2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GTF2F2
Protein GTF2F2 PDB 1bby.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GTF2F2, BTF4, RAP30, TF2F2, TFIIF, general transcription factor IIF subunit 2
Зовнішні ІД OMIM: 189969 MGI: 1915955 HomoloGene: 37884 GeneCards: GTF2F2
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004128
NM_026816
RefSeq (білок)
NP_004119
NP_081092
Локус (UCSC) Хр. 13: 45.12 – 45.28 Mb Хр. 14: 75.9 – 76.01 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GTF2F2 (англ. General transcription factor IIF subunit 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 13-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 249 амінокислот, а молекулярна маса — 28 380[4].

Послідовність амінокислот
1020304050
MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQG
RTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESS
SDKLSLEGIVVQRAECRPAASENYMRLKRLQIEESSKPVRLSQQLDKVVT
TNYKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLK
DLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEKSD

Кодований геном білок за функціями належить до гідролаз, геліказ, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання. Білок має сайт для зв'язування з АТФ, нуклеотидами, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Sopta M., Burton Z.F., Greenblatt J. (1989). Structure and associated DNA-helicase activity of a general transcription initiation factor that binds to RNA polymerase II.. Nature 341: 410 — 414.  PubMed DOI:10.1038/341410a0
  • Horikoshi M., Fujita H., Wang J., Takada R., Roeder R.G. (1991). Nucleotide and amino acid sequence of RAP30.. Nucleic Acids Res. 19: 5436 — 5436.  PubMed DOI:10.1093/nar/19.19.5436
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kim J.B., Yamaguchi Y., Wada T., Handa H., Sharp P.A. (1999). Tat-SF1 protein associates with RAP30 and human SPT5 proteins.. Mol. Cell. Biol. 19: 5960 — 5968.  PubMed DOI:10.1128/MCB.19.9.5960
  • Groft C.M., Uljon S.N., Wang R., Werner M.H. (1998). Structural homology between the Rap30 DNA-binding domain and linker histone H5: implications for preinitiation complex assembly.. Proc. Natl. Acad. Sci. U.S.A. 95: 9117 — 9122.  PubMed DOI:10.1073/pnas.95.16.9117

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4653 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P13984 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]