SATB2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SATB2
PDB 1wi3 EBI.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SATB2, GLSS, SATB homeobox 2
Зовнішні ІД OMIM: 608148 MGI: 2679336 HomoloGene: 32249 GeneCards: SATB2
Пов'язані генетичні захворювання
неспецифічний виразковий коліт, isolated cleft palate[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001172509
NM_001172517
NM_015265
NM_139146
NM_001358580
NM_001358581
RefSeq (білок)
NP_001165980
NP_001165988
NP_056080
NP_631885
NP_001345509
NP_001345510
Локус (UCSC) Хр. 2: 199.27 – 199.47 Mb Хр. 1: 56.79 – 56.98 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SATB2 (англ. SATB homeobox 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 733 амінокислот, а молекулярна маса — 82 555[5].

Послідовність амінокислот
1020304050
MERRSESPCLRDSPDRRSGSPDVKGPPPVKVARLEQNGSPMGARGRPNGA
VAKAVGGLMIPVFCVVEQLDGSLEYDNREEHAEFVLVRKDVLFSQLVETA
LLALGYSHSSAAQAQGIIKLGRWNPLPLSYVTDAPDATVADMLQDVYHVV
TLKIQLQSCSKLEDLPAEQWNHATVRNALKELLKEMNQSTLAKECPLSQS
MISSIVNSTYYANVSATKCQEFGRWYKKYKKIKVERVERENLSDYCVLGQ
RPMHLPNMNQLASLGKTNEQSPHSQIHHSTPIRNQVPALQPIMSPGLLSP
QLSPQLVRQQIAMAHLINQQIAVSRLLAHQHPQAINQQFLNHPPIPRAVK
PEPTNSSVEVSPDIYQQVRDELKRASVSQAVFARVAFNRTQGLLSEILRK
EEDPRTASQSLLVNLRAMQNFLNLPEVERDRIYQDERERSMNPNVSMVSS
ASSSPSSSRTPQAKTSTPTTDLPIKVDGANINITAAIYDEIQQEMKRAKV
SQALFAKVAANKSQGWLCELLRWKENPSPENRTLWENLCTIRRFLNLPQH
ERDVIYEEESRHHHSERMQHVVQLPPEPVQVLHRQQSQPAKESSPPREEA
PPPPPPTEDSCAKKPRSRTKISLEALGILQSFIHDVGLYPDQEAIHTLSA
QLDLPKHTIIKFFQNQRYHVKHHGKLKEHLGSAVDVAEYKDEELLTESEE
NDSEEGSEEMYKVEAEEENADKSKAAPAEIDQR

Кодований геном білок за функціями належить до репресорів, регуляторів хроматину, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Dobreva G., Dambacher J., Grosschedl R. (2003). SUMO modification of a novel MAR-binding protein, SATB2, modulates immunoglobulin mu gene expression.. Genes Dev. 17: 3048 — 3061.  PubMed DOI:10.1101/gad.1153003
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]