HOXA5

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HOXA5
Protein HOXA5 PDB 1hom.png
Ідентифікатори
Символи HOXA5, HOX1, HOX1.3, HOX1C, homeobox A5
Зовнішні ІД OMIM: 142952 MGI: 96177 HomoloGene: 40726 GeneCards: HOXA5
Шаблон експресії
PBB GE HOXA5 213844 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_019102
NM_010453
RefSeq (білок)
NP_061975
NP_034583
Локус (UCSC) Хр. 7: 27.14 – 27.14 Mb Хр. 6: 52.2 – 52.2 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HOXA5 (англ. Homeobox A5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 270 амінокислот, а молекулярна маса — 29 345[4].

Послідовність амінокислот
1020304050
MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQFRDSASMHSGRYGYGYN
GMDLSVGRSGSGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDP
LPCSAVAPSPGSDSHHGGKNSLSNSSGASADAGSTHISSREGVGTASGAE
EDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGGPEGKRART
AYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKW
KKDNKLKSMSMAAAGGAFRP

Кодований геном білок за функцією належить до білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Tournier-Lasserve E., Odenwald W.F., Garbern J., Trojanowski J., Lazzarini R.A. (1989). Remarkable intron and exon sequence conservation in human and mouse homeobox Hox 1.3 genes.. Mol. Cell. Biol. 9: 2273 — 2278.  PubMed DOI:10.1128/MCB.9.5.2273
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5106 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, P20719 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]