NR5A1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NR5A1
Protein NR5A1 PDB 1ymt.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR5A1, AD4BP, ELP, FTZ1, FTZF1, POF7, SF-1, SF1, SPGF8, SRXY3, hSF-1, nuclear receptor subfamily 5 group A member 1, SRXX4
Зовнішні ІД OMIM: 184757 MGI: 1346833 HomoloGene: 3638 GeneCards: NR5A1
Шаблон експресії
PBB GE NR5A1 210333 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004959
NM_139051
NM_001316687
RefSeq (білок)
NP_004950
NP_004950.2
NP_001303616
NP_620639
Локус (UCSC) Хр. 9: 124.48 – 124.51 Mb Хр. 2: 38.69 – 38.71 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR5A1 (англ. Nuclear receptor subfamily 5 group A member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 461 амінокислот, а молекулярна маса — 51 636[4].

Послідовність амінокислот
1020304050
MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCT
ESQSCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYK
RDRALKQQKKAQIRANGFKLETGPPMGVPPPPPPAPDYVLPPSLHGPEPK
GLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRAIKSEYPEP
YASPPQPGLPYGYPEPFSGGPNVPELILQLLQLEPDEDQVRARILGCLQE
PTKSRPDQPAAFGLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQN
CWSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVATQAGSLLHSLVLR
AQELVLQLLALQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAA
LLDYTLCHYPHCGDKFQQLLLCLVEVRALSMQAKEYLYHKHLGNEMPRNN
LLIEMLQAKQT

Кодований геном білок за функціями належить до рецепторів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання. Білок має сайт для зв'язування з ліпідами, іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Wong M., Ramayya M.S., Chrousos G.P., Driggers P.H., Parker K.L. (1996). Cloning and sequence analysis of the human gene encoding steroidogenic factor 1.. J. Mol. Endocrinol. 17: 139 — 147.  PubMed DOI:10.1677/jme.0.0170139
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Jacob A.L., Lund J., Martinez P., Hedin L. (2001). Acetylation of steroidogenic factor 1 protein regulates its transcriptional activity and recruits the coactivator GCN5.. J. Biol. Chem. 276: 37659 — 37664.  PubMed DOI:10.1074/jbc.M104427200
  • Lan H.-C., Li H.-J., Lin G., Lai P.-Y., Chung B.-C. (2007). Cyclic AMP stimulates SF-1-dependent CYP11A1 expression through homeodomain-interacting protein kinase 3-mediated Jun N-terminal kinase and c-Jun phosphorylation.. Mol. Cell. Biol. 27: 2027 — 2036.  PubMed DOI:10.1128/MCB.02253-06
  • Achermann J.C., Ito M., Ito M., Hindmarsh P.C., Jameson J.L. (1999). A mutation in the gene encoding steroidogenic factor-1 causes XY sex reversal and adrenal failure in humans.. Nat. Genet. 22: 125 — 126.  PubMed DOI:10.1038/9629
  • Biason-Lauber A., Schoenle E.J. (2000). Apparently normal ovarian differentiation in a prepubertal girl with transcriptionally inactive steroidogenic factor 1 (NR5A1/SF-1) and adrenocortical insufficiency.. Am. J. Hum. Genet. 67: 1563 — 1568.  PubMed DOI:10.1086/316893

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7983 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q13285 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]