HOXD9

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HOXD9
Protein HOXD9 PDB 1puf.png
Ідентифікатори
Символи HOXD9, HOX4, HOX4C, Hox-4.3, Hox-5.2, homeobox D9
Зовнішні ІД OMIM: 142982 MGI: 96210 HomoloGene: 8409 GeneCards: HOXD9
Шаблон експресії
PBB GE HOXD9 205604 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_014213
NM_013555
RefSeq (білок)
NP_055028
NP_038583
Локус (UCSC) Хр. 2: 176.12 – 176.12 Mb Хр. 2: 74.7 – 74.7 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HOXD9 (англ. Homeobox D9) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 352 амінокислот, а молекулярна маса — 36 495[4].

Послідовність амінокислот
1020304050
MLGGSAGRLKMSSSGTLSNYYVDSLIGHEGDEVFAARFGPPGPGAQGRPA
GVADGPAATAAEFASCSFAPRSAVFSASWSAVPSQPPAAAAMSGLYHPYV
PPPPLAASASEPGRYVRSWMEPLPGFPGGAGGGGGGGGGGPGRGPSPGPS
GPANGRHYGIKPETRAAPAPATAASTTSSSSTSLSSSSKRTECSVARESQ
GSSGPEFSCNSFLQEKAAAATGGTGPGAGIGAATGTGGSSEPSACSDHPI
PGCSLKEEEKQHSQPQQQQLDPNNPAANWIHARSTRKKRCPYTKYQTLEL
EKEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMSKEKCPK
GD

Кодований геном білок за функціями належить до білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5140 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, P28356 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]