BCL3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
BCL3
Protein BCL3 PDB 1k1a.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи BCL3, BCL4, D19S37, B-cell CLL/lymphoma 3, B cell CLL/lymphoma 3, transcription coactivator, BCL3 transcription coactivator
Зовнішні ІД OMIM: 109560 MGI: 88140 HomoloGene: 81738 GeneCards: BCL3
Шаблон експресії
PBB GE BCL3 204908 s at fs.png

PBB GE BCL3 204907 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005178
NM_033601
RefSeq (білок)
NP_005169
NP_291079
Локус (UCSC) Хр. 19: 44.75 – 44.76 Mb Хр. 7: 19.81 – 19.82 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

BCL3 (англ. B-cell CLL/lymphoma 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 454 амінокислот, а молекулярна маса — 47 584[4].

Послідовність амінокислот
1020304050
MPRCPAGAMDEGPVDLRTRPKAAGLPGAALPLRKRPLRAPSPEPAAPRGA
AGLVVPLDPLRGGCDLPAVPGPPHGLARPEALYYPGALLPLYPTRAMGSP
FPLVNLPTPLYPMMCPMEHPLSADIAMATRADEDGDTPLHIAVVQGNLPA
VHRLVNLFQQGGRELDIYNNLRQTPLHLAVITTLPSVVRLLVTAGASPMA
LDRHGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNYDGLTALHVAV
NTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGA
NVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVAR
SRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPS
SSPSQSPPRDPPGFPMAPPNFFLPSPSPPAFLPFAGVLRGPGRPVPPSPA
PGGS

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Ohno H., Takimoto G., McKeithan T.W. (1990). The candidate proto-oncogene bcl-3 is related to genes implicated in cell lineage determination and cell cycle control.. Cell 60: 991 — 997.  PubMed DOI:10.1016/0092-8674(90)90347-H
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • McKeithan T.W., Ohno H., Dickstein J., Hume E. (1994). Genomic structure of the candidate proto-oncogene BCL3.. Genomics 24: 120 — 126.  PubMed DOI:10.1006/geno.1994.1588
  • Heissmeyer V., Krappmann D., Wulczyn F.G., Scheidereit C. (1999). NF-kappaB p105 is a target of IkappaB kinases and controls signal induction of Bcl-3-p50 complexes.. EMBO J. 18: 4766 — 4778.  PubMed DOI:10.1093/emboj/18.17.4766
  • Watanabe N., Wachi S., Fujita T. (2003). Identification and characterization of BCL-3-binding protein: implications for transcription and DNA repair or recombination.. J. Biol. Chem. 278: 26102 — 26110.  PubMed DOI:10.1074/jbc.M303518200

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:998 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P20749 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]