E2F5

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
E2F5
Protein E2F5 PDB 1cf7.png
Ідентифікатори
Символи E2F5, E2F-5, E2F transcription factor 5
Зовнішні ІД OMIM: 600967 MGI: 105091 HomoloGene: 1472 GeneCards: E2F5
Шаблон експресії
PBB GE E2F5 221586 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001083588
NM_001083589
NM_001951
NM_007892
RefSeq (білок)
NP_001077057
NP_001077058
NP_001942
NP_031918
Локус (UCSC) Хр. 8: 85.18 – 85.22 Mb Хр. 3: 14.58 – 14.61 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

E2F5 (англ. E2F transcription factor 5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 346 амінокислот, а молекулярна маса — 37 610[4].

Послідовність амінокислот
1020304050
MAAAEPASSGQQAPAGQGQGQRPPPQPPQAQAPQPPPPPQLGGAGGGSSR
HEKSLGLLTTKFVSLLQEAKDGVLDLKAAADTLAVRQKRRIYDITNVLEG
IDLIEKKSKNSIQWKGVGAGCNTKEVIDRLRYLKAEIEDLELKERELDQQ
KLWLQQSIKNVMDDSINNRFSYVTHEDICNCFNGDTLLAIQAPSGTQLEV
PIPEMGQNGQKKYQINLKSHSGPIHVLLINKESSSSKPVVFPVPPPDDLT
QPSSQSLTPVTPQKSSMATQNLPEQHVSERSQALQQTSATDISSAGSISG
DIIDELMSSDVFPLLRLSPTPADDYNFNLDDNEGVCDLFDVQILNY

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біогенез та деградація війок, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Hijmans E.M., Voorhoeve P.M., Beijersbergen R.L., van 't Veer L.J., Bernards R. (1995). E2F-5, a new E2F family member that interacts with p130 in vivo.. Mol. Cell. Biol. 15: 3082 — 3089.  PubMed DOI:10.1128/MCB.15.6.3082
  • Vaishnav Y.N., Vaishnav M.Y., Pant V. (1998). The molecular and functional characterization of E2F-5 transcription factor.. Biochem. Biophys. Res. Commun. 242: 586 — 592.  PubMed DOI:10.1006/bbrc.1997.8010
  • Rubin S.M., Gall A.-L., Zheng N., Pavletich N.P. (2005). Structure of the Rb C-terminal domain bound to E2F1-DP1: a mechanism for phosphorylation-induced E2F release.. Cell 123: 1093 — 1106.  PubMed DOI:10.1016/j.cell.2005.09.044

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3119 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, Q15329 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]