STAT6

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
STAT6
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи STAT6, D12S1644, IL-4-STAT, STAT6B, STAT6C, signal transducer and activator of transcription 6
Зовнішні ІД OMIM: 601512 MGI: 103034 HomoloGene: 2373 GeneCards: STAT6
Пов'язані генетичні захворювання
eosinophilic esophagitis[1]
Шаблон експресії
PBB GE STAT6 201332 s at fs.png

PBB GE STAT6 201331 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001178078
NM_001178079
NM_001178080
NM_001178081
NM_003153
NM_009284
RefSeq (білок)
NP_001171549
NP_001171550
NP_001171551
NP_001171552
NP_003144
NP_033310
Локус (UCSC) Хр. 12: 57.1 – 57.13 Mb Хр. 10: 127.64 – 127.66 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

STAT6 (англ. Signal transducer and activator of transcription 6) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 847 амінокислот, а молекулярна маса — 94 135[5].

Послідовність амінокислот
1020304050
MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCC
NLASALLSDTVQHLQASVGEQGEGSTILQHISTLESIYQRDPLKLVATFR
QILQGEKKAVMEQFRHLPMPFHWKQEELKFKTGLRRLQHRVGEIHLLREA
LQKGAEAGQVSLHSLIETPANGTGPSEALAMLLQETTGELEAAKALVLKR
IQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQEVGAAGGELE
PKTRASLTGRLDEVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLGAPAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENS
IPGNCCSALFKNLLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLP
IQLQALSLPLVVIVHGNQDNNAKATILWDNAFSEMDRVPFVVAERVPWEK
MCETLNLKFMAEVGTNRGLLPEHFLFLAQKIFNDNSLSMEAFQHRSVSWS
QFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIGFISKQYVTSL
LLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTV
ERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSI
PPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQ
EHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQ
DLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLRANPSW

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Patel B.K., Keck C.L., O'Leary R.S., Popescu N.C., LaRochelle W.J. (1998). Localization of the human stat6 gene to chromosome 12q13.3-q14.1, a region implicated in multiple solid tumors.. Genomics 52: 192 — 200.  PubMed DOI:10.1006/geno.1998.5436
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Litterst C.M., Pfitzner E. (2002). An LXXLL motif in the transactivation domain of STAT6 mediates recruitment of NCoA-1/SRC-1.. J. Biol. Chem. 277: 36052 — 36060.  PubMed DOI:10.1074/jbc.M203556200

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]