ZFHX3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZFHX3
Protein ATBF1 PDB 2da1.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ZFHX3, ATBF1, ATBT, ZNF927, zinc finger homeobox 3
Зовнішні ІД OMIM: 104155 MGI: 99948 HomoloGene: 21366 GeneCards: ZFHX3
Пов'язані генетичні захворювання
інсульт, Ішемічна хвороба серця, Синдром Кавасакі, цереброваскулярні хвороби[1]
Шаблон експресії
PBB GE ATBF1 208033 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001164766
NM_006885
NM_007496
RefSeq (білок)
NP_001158238
NP_008816
н/д
Локус (UCSC) Хр. 16: 72.78 – 73.89 Mb Хр. 8: 107.94 – 108.96 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZFHX3 (англ. Zinc finger homeobox 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 3 703 амінокислот, а молекулярна маса — 404 419[5].

Послідовність амінокислот
1020304050
MEGCDSPVVSGKDNGCGIPQHQQWTELNSTHLPDKPSSMEQSTGESHGPL
DSLRAPFNERLAESTASAGPPSEPASKEVTCNECSASFASLQTYMEHHCP
SARPPPPLREESASDTGEEGDEESDVENLAGEIVYQPDGSAYIVESLSQL
TQGGGACGSGSGSGPLPSLFLNSLPGAGGKQGDPSCAAPVYPQIINTFHI
ASSFGKWFEGPDQAFPNTSALAGLSPVLHSFRVFDVRHKSNKDYLNSDGS
AKSSCVSKDVPNNVDLSKFDGFVLYGKRKPILMCFLCKLSFGYVRSFVTH
AVHDHRMTLSEDERKILSNKNISAIIQGIGKDKEPLVSFLEPKNKNFQHP
LVSTANLIGPGHSFYGKFSGIRMEGEEALPAGSAAGPEQPQAGLLTPSTL
LNLGGLTSSVLKTPITSVPLGPLASSPTKSSEGKDSGAAEGEKQEVGDGD
CFSEKVEPAEEEAEEEEEEEEAEEEEEEEEEEEEEEEDEGCKGLFPSELD
EELEDRPHEEPGAAAGSSSKKDLALSNQSISNSPLMPNVLQTLSRGTAST
SSNSASSFVVFDGANRRNRLSFNSEGVRANVAEGGRRLDFADESANKDNA
TAPEPNESTEGDDGGFVPHHQHAGSLCELGVGECPSGSGVECPKCDTVLG
SSRSLGGHMTMMHSRNSCKTLKCPKCNWHYKYQQTLEAHMKEKHPEPGGS
CVYCKSGQPHPRLARGESYTCGYKPFRCEVCNYSTTTKGNLSIHMQSDKH
LNNMQNLQNGGGEQVFSHTAGAAAAAVAAAAAAANISSSCGAPSPTKPKT
KPTWRCEVCDYETNVARNLRIHMTSEKHMHNMMLLQQNMTQIQHNRHLGL
GSLPSPAEAELYQYYLAQNMNLPNLKMDSAASDAQFMMSGFQLDPAGPMA
AMTPALVGGEIPLDMRLGGGQLVSEELMNLGESFIQTNDPSLKLFQCAVC
NKFTTDNLDMLGLHMNVERSLSEDEWKAVMGDSYQCKLCRYNTQLKANFQ
LHCKTDKHVQKYQLVAHIKEGGKANEWRLKCVAIGNPVHLKCNACDYYTN
SLEKLRLHTVNSRHEASLKLYKHLQQHESGVEGESCYYHCVLCNYSTKAK
LNLIQHVRSMKHQRSESLRKLQRLQKGLPEEDEDLGQIFTIRRCPSTDPE
EAIEDVEGPSETAADPEELAKDQEGGASSSQAEKELTDSPATSKRISFPG
SSESPLSSKRPKTAEEIKPEQMYQCPYCKYSNADVNRLRVHAMTQHSVQP
MLRCPLCQDMLNNKIHLQLHLTHLHSVAPDCVEKLIMTVTTPEMVMPSSM
FLPAAVPDRDGNSNLEEAGKQPETSEDLGKNILPSASTEQSGDLKPSPAD
PGSVREDSGFICWKKGCNQVFKTSAALQTHFNEVHAKRPQLPVSDRHVYK
YRCNQCSLAFKTIEKLQLHSQYHVIRAATMCCLCQRSFRTFQALKKHLET
SHLELSEADIQQLYGGLLANGDLLAMGDPTLAEDHTIIVEEDKEEESDLE
DKQSPTGSDSGSVQEDSGSEPKRALPFRKGPNFTMEKFLDPSRPYKCTVC
KESFTQKNILLVHYNSVSHLHKLKRALQESATGQPEPTSSPDNKPFKCNT
CNVAYSQSSTLEIHMRSVLHQTKARAAKLEAASGSSNGTGNSSSISLSSS
TPSPVSTSGSNTFTTSNPSSAGIAPSSNLLSQVPTESVGMPPLGNPIGAN
IASPSEPKEANRKKLADMIASRQQQQQQQQQQQQQQQQQQQAQTLAQAQA
QVQAHLQQELQQQAALIQSQLFNPTLLPHFPMTTETLLQLQQQQHLLFPF
YIPSAEFQLNPEVSLPVTSGALTLTGTGPGLLEDLKAQVQVPQQSHQQIL
PQQQQNQLSIAQSHSALLQPSQHPEKKNKLVIKEKEKESQRERDSAEGGE
GNTGPKETLPDALKAKEKKELAPGGGSEPSMLPPRIASDARGNATKALLE
NFGFELVIQYNENKQKVQKKNGKTDQGENLEKLECDSCGKLFSNILILKS
HQEHVHQNYFPFKQLERFAKQYRDHYDKLYPLRPQTPEPPPPPPPPPPPP
LPAAPPQPASTPAIPASAPPITSPTIAPAQPSVPLTQLSMPMELPIFSPL
MMQTMPLQTLPAQLPPQLGPVEPLPADLAQLYQHQLNPTLLQQQNKRPRT
RITDDQLRVLRQYFDINNSPSEEQIKEMADKSGLPQKVIKHWFRNTLFKE
RQRNKDSPYNFSNPPITSLEELKIDSRPPSPEPPKQEYWGSKRSSRTRFT
DYQLRVLQDFFDANAYPKDDEFEQLSNLLNLPTRVIVVWFQNARQKARKN
YENQGEGKDGERRELTNDRYIRTSNLNYQCKKCSLVFQRIFDLIKHQKKL
CYKDEDEEGQDDSQNEDSMDAMEILTPTSSSCSTPMPSQAYSAPAPSANN
TASSAFLQLTAEAEELATFNSKTEAGDEKPKLAEAPSAQPNQTQEKQGQP
KPELQQQEQPEQKTNTPQQKLPQLVSLPSLPQPPPQAPPPQCPLPQSSPS
PSQLSHLPLKPLHTSTPQQLANLPPQLIPYQCDQCKLAFPSFEHWQEHQQ
LHFLSAQNQFIHPQFLDRSLDMPFMLFDPSNPLLASQLLSGAIPQIPASS
ATSPSTPTSTMNTLKRKLEEKASASPGENDSGTGGEEPQRDKRLRTTITP
EQLEILYQKYLLDSNPTRKMLDHIAHEVGLKKRVVQVWFQNTRARERKGQ
FRAVGPAQAHRRCPFCRALFKAKTALEAHIRSRHWHEAKRAGYNLTLSAM
LLDCDGGLQMKGDIFDGTSFSHLPPSSSDGQGVPLSPVSKTMELSPRTLL
SPSSIKVEGIEDFESPSMSSVNLNFDQTKLDNDDCSSVNTAITDTTTGDE
GNADNDSATGIATETKSSSAPNEGLTKAAMMAMSEYEDRLSSGLVSPAPS
FYSKEYDNEGTVDYSETSSLADPCSPSPGASGSAGKSGDSGDRPGQKRFR
TQMTNLQLKVLKSCFNDYRTPTMLECEVLGNDIGLPKRVVQVWFQNARAK
EKKSKLSMAKHFGINQTSYEGPKTECTLCGIKYSARLSVRDHIFSQQHIS
KVKDTIGSQLDKEKEYFDPATVRQLMAQQELDRIKKANEVLGLAAQQQGM
FDNTPLQALNLPTAYPALQGIPPVLLPGLNSPSLPGFTPSNTALTSPKPN
LMGLPSTTVPSPGLPTSGLPNKPSSASLSSPTPAQATMAMGPQQPPQQQQ
QQQQPQVQQPPPPPAAQPPPTPQLPLQQQQQRKDKDSEKVKEKEKAHKGK
GEPLPVPKKEKGEAPTATAATISAPLPTMEYAVDPAQLQALQAALTSDPT
ALLTSQFLPYFVPGFSPYYAPQIPGALQSGYLQPMYGMEGLFPYSPALSQ
ALMGLSPGSLLQQYQQYQQSLQEAIQQQQQRQLQQQQQQKVQQQQPKASQ
TPVPPGAPSPDKDPAKESPKPEEQKNTPREVSPLLPKLPEEPEAESKSAD
SLYDPFIVPKVQYKLVCRKCQAGFSDEEAARSHLKSLCFFGQSVVNLQEM
VLHVPTGGGGGGSGGGGGGGGGGGGGGSYHCLACESALCGEEALSQHLES
ALHKHRTITRAARNAKEHPSLLPHSACFPDPSTASTSQSAAHSNDSPPPP
SAAAPSSASPHASRKSWPQVVSRASAAKPPSFPPLSSSSTVTSSSCSTSG
VQPSMPTDDYSEESDTDLSQKSDGPASPVEGPKDPSCPKDSGLTSVGTDT
FRL

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, міогенез, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Morinaga T., Yasuda H., Higashio K., Tamaoki T. (1991). A human alpha-fetoprotein enhancer-binding protein, ATBF1, contains four homeodomains and seventeen zinc fingers.. Mol. Cell. Biol. 11: 6041 — 6049.  PubMed DOI:10.1128/MCB.11.12.6041
  • Sun X., Li J., Dong F.N., Dong J.T. (2014). Characterization of nuclear localization and SUMOylation of the ATBF1 transcription factor in epithelial cells.. PLoS ONE 9: E92746 — E92746.  PubMed DOI:10.1371/journal.pone.0092746

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]