GATA5

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GATA5
Ідентифікатори
Символи GATA5, GATAS, bB379O24.1, GATA binding protein 5, CHTD5
Зовнішні ІД OMIM: 611496 MGI: 109497 HomoloGene: 32031 GeneCards: GATA5
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_080473
NM_008093
RefSeq (білок)
NP_536721
NP_032119
Локус (UCSC) Хр. 20: 62.46 – 62.48 Mb Хр. 2: 180.33 – 180.33 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GATA5 (англ. GATA binding protein 5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 397 амінокислот, а молекулярна маса — 41 299[4].

Послідовність амінокислот
1020304050
MYQSLALAASPRQAAYADSGSFLHAPGAGSPMFVPPARVPSMLSYLSGCE
PSPQPPELAARPGWAQTATADSSAFGPGSPHPPAAHPPGATAFPFAHSPS
GPGSGGSAGGRDGSAYQGALLPREQFAAPLGRPVGTSYSATYPAYVSPDV
AQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEFPGEGRECVNCGALSTPLW
RRDGTGHYLCNACGLYHKMNGVNRPLVRPQKRLSSSRRAGLCCTNCHTTN
TTLWRRNSEGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKTIAKA
RGSSGSTRNASASPSAVASTDSSAATSKAKPSLASPVCPGPSMAPQASGQ
EDDSLAPGHLEFKFEPEDFAFPSTAPSPQAGLRGALRQEAWCALALA

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Gu J.Y., Xu J.H., Yu H., Yang Y.Q. (2012). Novel GATA5 loss-of-function mutations underlie familial atrial fibrillation.. Clinics (Sao Paulo) 67: 1393 — 1399.  PubMed DOI:10.6061/clinics/2012(12)08
  • Padang R., Bagnall R.D., Richmond D.R., Bannon P.G., Semsarian C. (2012). Rare non-synonymous variations in the transcriptional activation domains of GATA5 in bicuspid aortic valve disease.. J. Mol. Cell. Cardiol. 53: 277 — 281.  PubMed DOI:10.1016/j.yjmcc.2012.05.009
  • Huang R.T., Xue S., Xu Y.J., Zhou M., Yang Y.Q. (2014). Somatic GATA5 mutations in sporadic tetralogy of Fallot.. Int. J. Mol. Med. 33: 1227 — 1235.  PubMed DOI:10.3892/ijmm.2014.1674

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:15802 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q9BWX5 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]