TFCP2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TFCP2
Ідентифікатори
Символи TFCP2, LBP1C, LSF, LSF1D, SEF, TFCP2C, transcription factor CP2
Зовнішні ІД OMIM: 189889 MGI: 98509 HomoloGene: 4134 GeneCards: TFCP2
Шаблон експресії
PBB GE TFCP2 209338 at fs.png

PBB GE TFCP2 207627 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005653
NM_001173452
NM_001173453
NM_001289603
NM_033476
NM_001355497
RefSeq (білок)
NP_001166923
NP_001166924
NP_005644
NP_001276532
NP_258437
NP_001342426
Локус (UCSC) Хр. 12: 51.09 – 51.17 Mb Хр. 15: 100.5 – 100.55 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TFCP2 (англ. Transcription factor CP2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 502 амінокислот, а молекулярна маса — 57 256[4].

Послідовність амінокислот
1020304050
MAWALKLPLADEVIESGLVQDFDASLSGIGQELGAGAYSMSDVLALPIFK
QEESSLPPDNENKILPFQYVLCAATSPAVKLHDETLTYLNQGQSYEIRML
DNRKLGELPEINGKLVKSIFRVVFHDRRLQYTEHQQLEGWRWNRPGDRIL
DIDIPMSVGIIDPRANPTQLNTVEFLWDPAKRTSVFIQVHCISTEFTMRK
HGGEKGVPFRVQIDTFKENENGEYTEHLHSASCQIKVFKPKGADRKQKTD
REKMEKRTPHEKEKYQPSYETTILTECSPWPEITYVNNSPSPGFNSSHSS
FSLGEGNGSPNHQPEPPPPVTDNLLPTTTPQEAQQWLHRNRFSTFTRLFT
NFSGADLLKLTRDDVIQICGPADGIRLFNALKGRMVRPRLTIYVCQESLQ
LREQQQQQQQQQQKHEDGDSNGTFFVYHAIYLEELTAVELTEKIAQLFSI
SPCQISQIYKQGPTGIHVLISDEMIQNFQEEACFILDTMKAETNDSYHII
LK

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Lim L.C., Swendeman S.L., Sheffery M. (1992). Molecular cloning of the alpha-globin transcription factor CP2.. Mol. Cell. Biol. 12: 828 — 835.  PubMed DOI:10.1128/MCB.12.2.828
  • Yoon J.-B., Li G., Roeder R.G. (1994). Characterization of a family of related cellular transcription factors which can modulate human immunodeficiency virus type 1 transcription in vitro.. Mol. Cell. Biol. 14: 1776 — 1785.  PubMed DOI:10.1128/MCB.14.3.1776
  • Shirra M.K., Zhu Q., Huang H.-C., Pallas D., Hansen U. (1994). One exon of the human LSF gene includes conserved regions involved in novel DNA-binding and dimerization motifs.. Mol. Cell. Biol. 14: 5076 — 5087.  PubMed DOI:10.1128/MCB.14.8.5076
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bing Z., Reddy S.A., Ren Y., Qin J., Liao W.S.-L. (1999). Purification and characterization of the serum amyloid A3 enhancer factor.. J. Biol. Chem. 274: 24649 — 24656.  PubMed DOI:10.1074/jbc.274.35.24649
  • Jane S.M., Nienhuis A.W., Cunningham J.M. (1995). Hemoglobin switching in man and chicken is mediated by a heteromeric complex between the ubiquitous transcription factor CP2 and a developmentally specific protein.. EMBO J. 14: 97 — 105.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11748 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q12800 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]